DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10462 and WIZ

Sequence 1:NP_609996.2 Gene:CG10462 FlyBaseID:FBgn0032815 Length:812 Species:Drosophila melanogaster
Sequence 2:XP_005260061.1 Gene:WIZ HGNCID:30917 Length:1889 Species:Homo sapiens

Alignment Length:799 Identity:153/800 (19%)
Similarity:250/800 (31%) Gaps:270/800 (34%)


  Fly   165 CSICRRHFESKQSLNLHRK---------QSQDFCSLLDF----------------------RKGS 198
            |.:|...||:::.|:.|.:         :|:...:.:|.                      :|.|
Human   977 CEVCGACFETRKGLSSHARSHLRQLGVAESESSGAPIDLLYELVKQKGLPDAHLGLPPGLAKKSS 1041

  Fly   199 SSK--------PELVAVSTPV-------------------------------------------- 211
            |.|        |.|::::.|:                                            
Human  1042 SLKEVVAGAPRPGLLSLAKPLDAPAVNKAIKSPPGFSAKGLGHPPSSPLLKKTPLALAGSPTPKN 1106

  Fly   212 PEESNCYVQIKEEPLNAEEADRMLLEDNPPLNVKLEPQDEEMPDVS------------------- 257
            ||:.:..:.:...|. :.:|.....||..|||:.|:.......|..                   
Human  1107 PEDKSPQLSLSPRPA-SPKAQWPQSEDEGPLNLTLDSDGGRELDCQLCGAWFETRKGLSSHARAH 1170

  Fly   258 ----RIKEEQSNGSVWTAIHTPLRN---KLRLP----ALA------TTKNQMHL---KPGVKRNG 302
                .:.:..:.||....:|..:|.   ::|||    |||      .|...:.|   .|..|:..
Human  1171 LRHLGVSDPDAKGSPIDVLHGLIRRDGVQIRLPPRRGALAHPGRPPPTSAALSLLPPPPPAKKAK 1235

  Fly   303 LLTSNVESLNKKSNHSV--------ISDDANIPI---SNQEPSN-----------------SSIA 339
            |..:.:.|...|.:.|.        .||....|:   |..||:.                 ||.|
Human  1236 LKAAGMASPWGKQDLSAAAAAGIFWASDVEPSPLNLSSGPEPARDIRCEFCGEFFENRKGLSSHA 1300

  Fly   340 ANILKVL-PSNCMVIKLPPNT--KIFK-----TPGQAPAAPKDSPTV---TLSGT-ENSTNFIKI 392
            .:.|:.: .:...|...|.:|  :|.|     .||..|..|..||..   .:.|. ..|:...:.
Human  1301 RSHLRQMGVTEWYVNGSPIDTLREILKRRTQSRPGGPPNPPGPSPKALAKMMGGAGPGSSLEARS 1365

  Fly   393 PKTISISTVGSM-----GNPHASAKTVQPTQTHSRSSCFLVDSFNNSKSRPESMKIINEFRNQIR 452
            |..:.||.:...     |:|...:.|..|..|..:....|.......|.:||.:::  |.:.:: 
Human  1366 PSDLHISPLAKKLPPPPGSPLGHSPTASPPPTARKMFPGLAAPSLPKKLKPEQIRV--EIKREM- 1427

  Fly   453 SIEKTLPLPGTV---LQSSKVTMDESTSSPMDAPKPVELMLN-PSALMVARELEIQYPLYRFMWT 513
                   |||.:   |..|:        .|..||:.....|| .|.....|::.           
Human  1428 -------LPGALHGELHPSE--------GPWGAPREDMTPLNLSSRAEPVRDIR----------- 1466

  Fly   514 CPLCQRMFEKHCAF----RAHLTNKHDLTDEKCNVLKVVLMPSKILSQDSANAATQRVHVPLNPQ 574
            |..|...||.....    |:|| .:..:|:...|...:..: .:||.:.|.....:: ..|....
Human  1467 CEFCGEFFENRKGLSSHARSHL-RQMGVTEWSVNGSPIDTL-REILKKKSKPCLIKK-EPPAGDL 1528

  Fly   575 TPV-----PPPELPNTVNLPLLLSKTSAPLTGQTSALSNVP--VNKGLSPTSINIEKPK------ 626
            .|.     ||...|..|..||.||    ||.|:.......|  |.:.||.|.|...||.      
Human  1529 APALAEDGPPTVAPGPVQSPLPLS----PLAGRPGKPGAGPAQVPRELSLTPITGAKPSATGYLG 1589

  Fly   627 --VSKKPKKNQSFQCTECLKVFTTFGALRIHKSIHTGELPYQCSYCDKRFRTPGQVRVHHRRHTG 689
              .:|:|.:.......|          ::....|.| |||::..            .:|.:....
Human  1590 SVAAKRPLQEDRLLPAE----------VKAKTYIQT-ELPFKAK------------TLHEKTSHS 1631

  Fly   690 EKPFKCKICSLDFTHRETLISHLSRHIGMKRYKCYGCDKYFV---VVSGLRAHRRLRPDTCGKV- 750
            .....|::|.|.|.:|:.|.||...|:     :.:|..::.|   .:..|....:.||...|.. 
Human  1632 STEACCELCGLYFENRKALASHARAHL-----RQFGVTEWCVNGSPIETLSEWIKHRPQKVGAYR 1691

  Fly   751 -----------KFTARAHG 758
                       ||.:..||
Human  1692 SYIQGGRPFTKKFRSAGHG 1710

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10462NP_609996.2 C2H2 Zn finger 137..157 CDD:275371
C2H2 Zn finger 165..186 CDD:275371 7/30 (23%)
C2H2 Zn finger 639..659 CDD:275368 2/20 (10%)
zf-H2C2_2 651..676 CDD:290200 5/25 (20%)
C2H2 Zn finger 667..687 CDD:275368 1/20 (5%)
zf-H2C2_2 680..704 CDD:290200 5/24 (21%)
C2H2 Zn finger 695..715 CDD:275368 8/20 (40%)
C2H2 Zn finger 723..742 CDD:275368 3/22 (14%)
WIZXP_005260061.1 C2H2 Zn finger 317..337 CDD:275368
C2H2 Zn finger 354..374 CDD:275368
C2H2 Zn finger 403..423 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24396
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.