DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10462 and zf30C

Sequence 1:NP_609996.2 Gene:CG10462 FlyBaseID:FBgn0032815 Length:812 Species:Drosophila melanogaster
Sequence 2:NP_477301.1 Gene:zf30C FlyBaseID:FBgn0270924 Length:777 Species:Drosophila melanogaster

Alignment Length:828 Identity:181/829 (22%)
Similarity:290/829 (35%) Gaps:243/829 (29%)


  Fly    76 PK-HCDICQYKFKSQQDISSHRVHHEMNLHF-CRLGCGIWLDTLEKILEHEYRQHFQPGRV---- 134
            || ||.:|.....|......|...|:....| || .|.......|::.:|...:|...|.|    
  Fly    29 PKLHCPVCNKALVSLAGYVKHVKKHQPPGGFECR-HCDARFCHEEELTQHAKDEHGVTGAVAGQE 92

  Fly   135 ---LCCRVCDFMANSADDLASHMQKHIYVYR-------------------FVCSICRRHFESKQS 177
               ..|..|     .|:      .|:...||                   ..|..|...|.|..:
  Fly    93 RKPFVCEKC-----GAE------YKYQEAYRRHCRTKCGEEKLPREESRPMECKCCYTRFSSASN 146

  Fly   178 LNLHRKQSQDFCSLLDFRKGSSS------------------------KPELVAVSTPVPEESNCY 218
            |:.||:...|.|...::....||                        ..|.......:|..|...
  Fly   147 LSKHRRSRPDTCGQPEYDSPGSSDGMKKHKAFRKKDRNRDSDDEDTTSEESEDSDDDIPLASRLK 211

  Fly   219 VQIKE--------------EPLNAE-EADRMLLEDNPPLNVKLEPQDE---EMPDVSRIKEEQSN 265
            .::|:              ||.|:| :||....:..||..||:|..||   |..|.|...:.:| 
  Fly   212 TKLKQESQNSDSGDECPDFEPNNSEDDADASGFQLPPPAMVKVEAFDEEDFEYQDASMYVKTES- 275

  Fly   266 GSVWTAIHTPLRNKLRLPALATTKNQMHLKPGVKRNGLLTSNVESLNKKSNHSVISDDANIPISN 330
                |.|.:..::|| |..|....:  .|||           .|||..:....::.:.|.:|:..
  Fly   276 ----TDIFSNEKDKL-LDVLLNEGD--GLKP-----------FESLKVEQGAGILDEIAAVPLVE 322

  Fly   331 QEPSNSSIAANILKVLPSNCMVIKLPPNTKIFKTPGQAPAAPKDS-PTVTLSGTENSTNFIKIPK 394
            ....:         ||......::.||.      |.:....||:. |.|.....:.:.     |:
  Fly   323 VAEED---------VLELRGHQMEKPPG------PRKRGRPPKEKIPVVKRKYRKRNA-----PR 367

  Fly   395 TISISTVGSMGNPHASAKTVQPTQTHSRSSCFLVDSFNNSKSRPESMKIINEFRNQIRSIEKTLP 459
              |.|...|.|.|...||.                   :.|...|.:|:||:       :||:..
  Fly   368 --SPSPDDSSGTPKRVAKI-------------------SKKELKERLKMINK-------MEKSWK 404

  Fly   460 LPGTVLQSSKVTMDESTSSPMDAPKPVEL------MLNPSALM-VARELEIQYPLYRFMWTCPLC 517
            .|..|    |:         ....||.|.      .||.:.:. :.:::::...|...::.||:|
  Fly   405 CPHCV----KI---------YHIRKPYEKHLRDDHKLNEAEMKEIFKDVDVHAKLDEEVFKCPIC 456

  Fly   518 QRMF--EKH-------------------CAFRAHLTNKHDLTD------------EKCNVLKVVL 549
            .:::  ||.                   |........|...|:            |||:      
  Fly   457 SKIYLVEKRLVTHMKVHGEDGKLTFKCPCYCNLFFATKEQATEHARAQHKELLYCEKCD------ 515

  Fly   550 MPSKILSQDSANAATQRVHVPLNPQTPVPPPELPNTVNLPLLLSKTSAPLTGQTSALSNVPVNKG 614
              ..:...||.....:..|....|::.          ...|:..|.....||:||...:|..:.|
  Fly   516 --KYMTGHDSLKNHERNFHSKKEPRSQ----------QRNLICDKCGKKFTGRTSLSDHVRSDCG 568

  Fly   615 LSPTSINIEKPKVSKKPKKNQSFQCTECLKVFTTFGALRIHKSIHTGELPYQCSYCDKRFRTPGQ 679
            ..|.                  :.|:.|.|..:|.|.|:.|..:|..:.||||..|.|.|:...|
  Fly   569 RLPL------------------YGCSVCGKHLSTAGILKTHMLLHKADTPYQCDKCGKTFKVKAQ 615

  Fly   680 VRVHHR-RHTGEKPFKCKICSLDFTHRETLISHLSRHIGMKRYKCYGCDKYFVVVSGLRAHRRLR 743
            .:.|.: |||..||:||.:|..::.:||:|::|::.|.|:||:.|..|.|.|..:|.|:|||::.
  Fly   616 YKSHLKTRHTDYKPYKCHLCPKEYPYRESLLTHMTVHTGIKRFLCNNCGKRFTCISNLQAHRKVH 680

  Fly   744 PDTCGKVKFTARAHGPRVRVIRGEVVFQYHPEHNGYLRSEDPLNILSQ 791
            .||||::...|:| ...:.|.||:::....||..  :..|:...:::|
  Fly   681 ADTCGQLPLNAKA-TQYMGVQRGKLLMGAKPEAG--MEYEETKTLIAQ 725

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10462NP_609996.2 C2H2 Zn finger 137..157 CDD:275371 4/20 (20%)
C2H2 Zn finger 165..186 CDD:275371 7/21 (33%)
C2H2 Zn finger 639..659 CDD:275368 7/20 (35%)
zf-H2C2_2 651..676 CDD:290200 10/25 (40%)
C2H2 Zn finger 667..687 CDD:275368 7/21 (33%)
zf-H2C2_2 680..704 CDD:290200 9/25 (36%)
C2H2 Zn finger 695..715 CDD:275368 6/20 (30%)
C2H2 Zn finger 723..742 CDD:275368 9/19 (47%)
zf30CNP_477301.1 C2H2 Zn finger 33..53 CDD:275368 4/20 (20%)
C2H2 Zn finger 61..82 CDD:275368 5/22 (23%)
C2H2 Zn finger 98..117 CDD:275368 6/30 (20%)
C2H2 Zn finger 134..152 CDD:275368 7/18 (39%)
C2H2 Zn finger 511..532 CDD:275370 5/29 (17%)
COG5048 <523..>672 CDD:227381 50/177 (28%)
C2H2 Zn finger 546..566 CDD:275368 6/20 (30%)
C2H2 Zn finger 575..595 CDD:275368 7/20 (35%)
C2H2 Zn finger 603..624 CDD:275368 7/21 (33%)
C2H2 Zn finger 632..652 CDD:275368 6/20 (30%)
C2H2 Zn finger 660..680 CDD:275368 9/20 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E33208_3BRQ6
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.