DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10462 and lin-29

Sequence 1:NP_609996.2 Gene:CG10462 FlyBaseID:FBgn0032815 Length:812 Species:Drosophila melanogaster
Sequence 2:NP_496545.1 Gene:lin-29 WormBaseID:WBGene00003015 Length:459 Species:Caenorhabditis elegans

Alignment Length:209 Identity:58/210 (28%)
Similarity:84/210 (40%) Gaps:41/210 (20%)


  Fly   580 PELPNTVNLPLLLSKTSAPLTGQTSALSNVPVNKGLSPTSINIEK---------------PKVSK 629
            |...:..||.:.||:.|  :...|:|.|..|.........:|..:               |:..:
 Worm    70 PAHHSITNLNMALSQHS--IDSATAASSTNPFPHFNQADLLNFHQNSLLPHHMFSQFGRYPQFEQ 132

  Fly   630 KP-----------KKNQSFQCTECLKVFTTFGALRIHKSIHTGELPY-QCSYCDKRFRTPGQVRV 682
            ||           ::.:.::||:|:|.|.....|..|..||.|..|: .|:||.|:|.....::.
 Worm   133 KPDVGVLQQQMQMREAKPYKCTQCVKAFANSSYLSQHMRIHLGIKPFGPCNYCGKKFTQLSHLQQ 197

  Fly   683 HHRRHTGEKPFKCKI--CSLDFTHRETLISHLSRHIGMKRYKCYGCDKYFVVVSGLRAHRRLRPD 745
            |.|.||||||:|||.  |...|:....|.||...|...|.:||..|.|.|.....|..|.....:
 Worm   198 HIRTHTGEKPYKCKFTGCDKAFSQLSNLQSHSRCHQTDKPFKCNSCYKCFTDEQSLLDHIPKHKE 262

  Fly   746 T----------CGK 749
            :          |||
 Worm   263 SKHLKIHICPFCGK 276

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10462NP_609996.2 C2H2 Zn finger 137..157 CDD:275371
C2H2 Zn finger 165..186 CDD:275371
C2H2 Zn finger 639..659 CDD:275368 8/20 (40%)
zf-H2C2_2 651..676 CDD:290200 11/26 (42%)
C2H2 Zn finger 667..687 CDD:275368 7/20 (35%)
zf-H2C2_2 680..704 CDD:290200 13/26 (50%)
C2H2 Zn finger 695..715 CDD:275368 7/22 (32%)
C2H2 Zn finger 723..742 CDD:275368 6/19 (32%)
lin-29NP_496545.1 zf-C2H2 151..173 CDD:278523 8/22 (36%)
C2H2 Zn finger 153..173 CDD:275368 8/20 (40%)
zf-H2C2_2 165..191 CDD:290200 11/26 (42%)
zf-C2H2_8 181..265 CDD:292531 30/84 (36%)
C2H2 Zn finger 182..202 CDD:275368 7/20 (35%)
zf-C2H2 182..202 CDD:278523 7/20 (35%)
zf-H2C2_2 194..221 CDD:290200 13/27 (48%)
C2H2 Zn finger 210..232 CDD:275368 7/22 (32%)
zf-H2C2_2 224..248 CDD:290200 10/24 (42%)
C2H2 Zn finger 240..269 CDD:275368 6/29 (21%)
zf-C2H2 269..291 CDD:278523 3/9 (33%)
C2H2 Zn finger 271..291 CDD:275368 3/7 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.