DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10462 and znf644b

Sequence 1:NP_609996.2 Gene:CG10462 FlyBaseID:FBgn0032815 Length:812 Species:Drosophila melanogaster
Sequence 2:XP_003198829.2 Gene:znf644b ZFINID:ZDB-GENE-120214-23 Length:1267 Species:Danio rerio

Alignment Length:1036 Identity:192/1037 (19%)
Similarity:304/1037 (29%) Gaps:427/1037 (41%)


  Fly     7 KMEPQDEVTDSSIRILSACD---TLKIL---------DEGSQMITVPI-----RDRLRSEDERLF 54
            :.||:.....:.:|:...||   .:|.|         |||...:....     ..||::|     
Zfish   314 RKEPESLKAYAGLRLEKFCDKSAAMKELISSEKEERCDEGGSDVETNTYMGEKLARLKTE----- 373

  Fly    55 IASLELGHQQIFASESEDNPNPKHCDICQYKFKSQQDISSHRVHHEMNLHFCRLGCGIWLDTLEK 119
               .:.|.:..|..          |..|...||.::.:..|.::|              ||...|
Zfish   374 ---TKTGEELSFFP----------CSKCNETFKEKRHLHRHMMYH--------------LDRNNK 411

  Fly   120 ILEHEYRQHFQPGRVLCCRVCDFMANSADDLASHMQKHIYVY---------------------RF 163
            :     ||...| |...||.|   ..|..||.| :|||:.::                     |.
Zfish   412 V-----RQEHVP-RPFICREC---GRSFRDLTS-LQKHMIIHQVRRERLMEEIKGFSKIDVEGRR 466

  Fly   164 VCSICRR-HFESKQSLNLHR-----KQSQDFC--SLLDFRKGSSSKPELVAVSTPVPEESNCYV- 219
            .|..|.: .|.:|......|     ::.:.:|  ......|......|..|......:..:|:. 
Zfish   467 ACLQCPQCVFGTKCPKTFIRCGKTNEKEKPYCFEDCHHMTKSEVEAHECTAHHNTCAKTEDCFAC 531

  Fly   220 ------------------QIKEEPLNAEEADRMLLEDNPPLNVKLEPQDEEMPDVSRIKEEQSNG 266
                              .|..:|...:      .|..|..||..:|:.:::             
Zfish   532 QNCTFTSNNRFSFRKHVELIHRQPYYDD------YEPQPHSNVDDQPKTKDL------------- 577

  Fly   267 SVWTAIHTPLRNKLRLPALATT-------KNQMHLKPGVKRNGLLTSNVES-------------- 310
                        .|.:|.:.:|       :.::..:|    ||....||.|              
Zfish   578 ------------SLPMPKIQSTEKWSVKDRGELPFRP----NGSADLNVRSEETQKACDGFSLSL 626

  Fly   311 --------LNKKSNHSVISDDAN------------------IPISNQEPSNSSIAANILKVLPSN 349
                    .||.|..|:.||..:                  :...||| ..|:::....|.|.| 
Zfish   627 IKWSPGSPANKLSPFSLRSDKPSKLSPLPTEKIDVTTGLPYVEEDNQE-YESTVSEKRTKYLSS- 689

  Fly   350 CMVIKLPPNTKIFK-----TPG--QAPAAPKDSPTVTLSGTENSTNFIKIP--KTISISTVGSMG 405
             ....|...|:|..     .||  ..|..|..|.|:.|....:     |||  :.:||....:..
Zfish   690 -FDAHLTAKTEIVSKAACLNPGTESRPKDPSTSSTLALQTLRH-----KIPSKRKMSIPYRNTHA 748

  Fly   406 N-PHAS------------AKTVQP--------------------TQTHSRSSCFLVDSFNN---- 433
            : ||.|            :.|.|.                    .|:::.|..|:  .|||    
Zfish   749 DIPHVSLPECESESPQWDSSTPQEGDDYEGAQDFSKCTKESPDWFQSNTPSDYFI--PFNNNIPD 811

  Fly   434 --SKSRPESMKIINEFRNQIRS-------IEKTLPLPGTVLQSSKVTMDESTSSPMDAPKPV-EL 488
              |.|.||..  |.|..::||:       ||.|:         |:...|||.....|   |. :.
Zfish   812 YASHSNPEDS--IEEDSDEIRTFIIKEECIESTI---------SEDNPDESVYQQSD---PYGQY 862

  Fly   489 MLNPSALMVARELEIQYPLYRFMWTCPLCQRMFEKHCAF----RAHLTN---KHDLTDEKCNVLK 546
            :::|.: :|.|:            .||.|..:||.....    |.||..   .:|        .:
Zfish   863 VVSPFS-VVGRK------------CCPYCPAVFESGVGLSNHVRGHLYRVGLSYD--------AR 906

  Fly   547 VVLMPSKILSQDSANAATQRVHVPLNPQTPVPPPELPNTVNLPLLL----SKT--SAPLTGQTSA 605
            .|:.|.::.|||......::: ..:|.:.....||.......||.|    :||  |..:.|....
Zfish   907 HVVSPEQVASQDRQPRIRRKI-PSVNRRIRKDKPESKTEHTCPLCLGWFDTKTGLSNHVRGHLKR 970

  Fly   606 LSNVPVNKGLSPTSI------------NI-----EKPKVSKKPKKNQSFQCTECLKVFTTFGALR 653
            :.........||.||            ||     .:|::| ||..::.|  ..|..:|.|...  
Zfish   971 IGKPISGASKSPLSILSELLQDETEYKNIMRVFGSRPQLS-KPFVSRKF--ASCDGLFLTSSG-- 1030

  Fly   654 IHKSIHTG-------------------------------------------ELPYQ--------- 666
            |...||.|                                           |:..:         
Zfish  1031 IPMKIHHGTSKPDEGHWTMIRPPQVDRERKKTDKVQSSTLEDLLGNREVEQEMEVEDHSEEASTP 1095

  Fly   667 ---CSYCDKRFRTP--------GQVRVHHRRHTGEKPFKCKICSLDFTHRETLISHL-----SRH 715
               .|.||...|||        .|.:....::|      |..|::.|....:|.:||     .:.
Zfish  1096 LTIYSTCDGIPRTPSVKLDPTWSQEKFAANKNT------CIHCNMTFHSGVSLSNHLRAYARRKK 1154

  Fly   716 IGMKRYKCYGCDKYFVVVSGLRAHRRLRPDTCGKVKFTARAHGPRVRVIR-----GEVVFQ 771
            |.::....|.|.         :...|.||             ||:.:|..     .||:::
Zfish  1155 IAIEEGTTYDCK---------QKRPRSRP-------------GPKRKVFSSSHAVSEVIYR 1193

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10462NP_609996.2 C2H2 Zn finger 137..157 CDD:275371 9/20 (45%)
C2H2 Zn finger 165..186 CDD:275371 5/27 (19%)
C2H2 Zn finger 639..659 CDD:275368 5/20 (25%)
zf-H2C2_2 651..676 CDD:290200 9/80 (11%)
C2H2 Zn finger 667..687 CDD:275368 7/28 (25%)
zf-H2C2_2 680..704 CDD:290200 4/24 (17%)
C2H2 Zn finger 695..715 CDD:275368 6/25 (24%)
C2H2 Zn finger 723..742 CDD:275368 3/19 (16%)
znf644bXP_003198829.2 C2H2 Zn finger 385..405 CDD:275370 5/20 (25%)
zf-C2H2 421..443 CDD:306579 10/26 (38%)
C2H2 Zn finger 423..443 CDD:275370 10/24 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24396
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.