DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG10462 and znf644a

Sequence 1:NP_609996.2 Gene:CG10462 FlyBaseID:FBgn0032815 Length:812 Species:Drosophila melanogaster
Sequence 2:NP_001265183.1 Gene:znf644a ZFINID:ZDB-GENE-030131-6244 Length:1169 Species:Danio rerio

Alignment Length:879 Identity:176/880 (20%)
Similarity:289/880 (33%) Gaps:257/880 (29%)


  Fly    42 IRDRLRSEDE--RLF-----IASLELGHQQIFASESEDNPNP---KHCDICQYKFKS-QQDISSH 95
            ||:.|.|:.|  ..|     .....||..||..::...:..|   |.|..|.|...| ...||.|
Zfish   305 IRETLSSDSEGPTFFQQNNDFKEKSLGQNQITCNKDTTSSKPFVCKECGQCYYDRSSLLNHISVH 369

  Fly    96 RVHHEMNLHFCRL------------GCGIWLDTLEKILEHEYRQHFQPGRVLCCRVCDFMANSAD 148
            :...:....|.::            .|....:.....::|. :.|.:..|...|..|||:..:.|
Zfish   370 QDKGKKLNQFHQIKDEGKDAKLQCPQCNFGTNCPNTFVQHA-KTHEKDKRYYSCNKCDFVEMNED 433

  Fly   149 DLASHMQKHIYVYRFVCSICRRHFESKQSLNLHRKQSQDFCSLLDFRKGSSSKPELVAVSTPVPE 213
            ||    ::|:|....|  |...|...|......||.::..|  |:....|..:....:|...|.|
Zfish   434 DL----RRHLYHKHGV--IGADHTVWKSDGFQERKVNKSPC--LNSYSPSFERKTKNSVGNHVEE 490

  Fly   214 E---SNCYVQIKEEPLNAEE---ADRMLLE------DNPPLNVKLEPQDEE------MPDVSRIK 260
            |   |:......|||...|:   |..:|..      .:|.|.||....|||      ...:.|.|
Zfish   491 EQVNSHSLDSGDEEPPTTEQSFSACNVLTSCAKPKARSPRLLVKFGAPDEENNLSNDKCGLLRKK 555

  Fly   261 EEQSNGSVWTAIHTPLRNKLRL------------PALATTKNQMHLKPGVKRNGLLTSNVES-LN 312
            :......:..:|||.|..|.|.            ||.::||..:......:.....||:..| ..
Zfish   556 KRVGESKLDKSIHTLLSRKKRRDKSGSEIDTHQEPAKSSTKEFLDRSLNCETTFSETSSPPSKYL 620

  Fly   313 KKSNHSVISD-------DANIPISNQE-PSNSSIAANILKVLPS-------------NCMVIKLP 356
            |:|.||...:       |.|:..|... .::..:....||..||             ..:::..|
Zfish   621 KRSAHSKEGNTKRTSKFDVNVTCSEDAGKTHLGLEKQTLKKSPSKRKMSTPFHNMQGQDILLDFP 685

  Fly   357 PNTKIFKTPGQAPAAPKDSPTVTLSGTENSTNFIKIPKTISISTVGSMG------NPHASAKTVQ 415
            ...:.||.|               ..|......|.....:|:|: .::|      :.:|:|:.|:
Zfish   686 KCRQKFKKP---------------QATRRRKVLINNSDILSVSS-DALGPEECEMDKNANARLVK 734

  Fly   416 PTQTHSRSSCFLVDS-FNNSKSRPESMKIINEFRNQ-----IRSIE-----------KTLPLPGT 463
            ...:.|::|.....| |..:.|.|..:.:.:|::::     |.:::           |..|....
Zfish   735 RRSSSSKASLGASASHFERNHSSPRVLSVKDEYKDEEISESITAVKLEPSSDVETDLKGCPYCPA 799

  Fly   464 VLQS-------------------------------------------SKVTMDESTSSPMDAPKP 485
            |.:|                                           |:|..:|.||   ....|
Zfish   800 VFESGISLSNHIRGHLHRVGLKVRRAPVKSAVKVASDKVPPVRRQALSQVKTEEDTS---QTDHP 861

  Fly   486 VELMLNPSALMVARELEIQYPLYRFMWTCPLCQRMFEKHCAF----RAHLTN------------- 533
            .||..:      .::.|:         .||||:..|:.....    |.||..             
Zfish   862 AELPTD------CQQTEL---------ICPLCREWFDNRTGLSNHVRGHLKRLGKPTSTASKSPV 911

  Fly   534 ---KHDLTDEKCNVLKVVLMPSKILSQDS------ANAAT-------------QRVHVPLNPQTP 576
               |..:.|:|...||:.::..|..:.::      .|..|             ::..:.:|..: 
Zfish   912 IILKELMRDKKQFQLKLQVLEKKCRTTNTFYPVRLGNGLTFASTVKRQKDDKEEKKRLEINKGS- 975

  Fly   577 VPPPELPNTVNLPLLLSKTSAPLTGQTSALSNVPVNKGLSPTS-------INIEKPKVSKKPKK- 633
             ||.:|..      :|.|..|....:....| :...|.||.||       |:..|...|...:| 
Zfish   976 -PPSDLIG------ILKKRRAHEEAKAKHQS-LTAKKALSLTSGKDCGLEIHTCKAVPSSPGEKG 1032

  Fly   634 -NQSFQCTECLKVFTTFGALRIH---------KSIHTGELPYQCSYCDKRFRTPGQVRVHHRRHT 688
             |:...|..|...|.:..:|..|         |::..| ....|....:|.|...:.:.....|.
Zfish  1033 DNKRNVCVHCNASFHSGISLSNHLRGYSQRKRKALQDG-ATLDCKQRKQRARPWSKKKAFSLMHN 1096

  Fly   689 GEKPFK--CKICSLDF----THRETLISHLSRHI 716
            .|:.::  |:.|.|.|    :.:|..|.||.|||
Zfish  1097 PEEIYRLTCRFCDLVFQGPLSVQEDWIKHLQRHI 1130

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10462NP_609996.2 C2H2 Zn finger 137..157 CDD:275371 7/20 (35%)
C2H2 Zn finger 165..186 CDD:275371 5/21 (24%)
C2H2 Zn finger 639..659 CDD:275368 6/29 (21%)
zf-H2C2_2 651..676 CDD:290200 7/34 (21%)
C2H2 Zn finger 667..687 CDD:275368 3/20 (15%)
zf-H2C2_2 680..704 CDD:290200 6/30 (20%)
C2H2 Zn finger 695..715 CDD:275368 9/24 (38%)
C2H2 Zn finger 723..742 CDD:275368
znf644aNP_001265183.1 C2H2 Zn finger 349..369 CDD:275368 7/20 (35%)
C2H2 Zn finger 393..413 CDD:275368 2/21 (10%)
C2H2 Zn finger 422..439 CDD:275368 8/21 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24396
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.