DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hakai and CBLL1

Sequence 1:NP_001260593.1 Gene:Hakai FlyBaseID:FBgn0032812 Length:473 Species:Drosophila melanogaster
Sequence 2:XP_016868132.1 Gene:CBLL1 HGNCID:21225 Length:531 Species:Homo sapiens

Alignment Length:486 Identity:131/487 (27%)
Similarity:179/487 (37%) Gaps:155/487 (32%)


  Fly    89 GALGAVAASGNMTPATQQPQVLQQVPPPVMSQTTISLSLARAV--DMEA-DISQLE------APT 144
            |:||.:.....:.......|..:..|.| .:|.||:...|:|.  |.|. |.::.|      ...
Human    55 GSLGGLDVRRRIPIKLISKQANKAKPAP-RTQRTINRMPAKAPPGDEEGFDYNEEERYDCKGGEL 118

  Fly   145 FTTLSRGPPEPMLRLKWNHKVSLIGEKVLNPMIHCCDQCDKPILVYGRMIPCKHVFCLKCA---R 206
            |....|.|.    .|.|:.:::::|||...| :|.||:|..||.:||||||||||||..||   .
Human   119 FANQRRFPG----HLFWDFQINILGEKDDTP-VHFCDKCGLPIKIYGRMIPCKHVFCYDCAILHE 178

  Fly   207 AEPIKSCPRCTDKVLRVEQSGLGTVFMCTHGGSRYGSSGCRRTYLSQRDLQAHINHRHV-APQP- 269
            .:..|.||.|:|.|.|:||...|::|||:.      ..||:|||||||||||||||||: |.:| 
Human   179 KKGDKMCPGCSDPVQRIEQCTRGSLFMCSI------VQGCKRTYLSQRDLQAHINHRHMRAGKPV 237

  Fly   270 ---------PPLQPQPQLSAMAEQPKMTDLGGVGLGLELHKQRKLSESSVPISVSASIASRPV-- 323
                     ||:.|.|     .|.|:..          :....|...|.:|......:...|:  
Human   238 TRASLENVHPPIAPPP-----TEIPERF----------IMPPDKHHMSHIPPKQHIMMPPPPLQH 287

  Fly   324 -------------------LSRLPLTGGVGNIGSIGSIPPPGSAAAAQNAIH-GGHSTLTLANLT 368
                               ||..|              |||.|.:.....|. ..||.|....:.
Human   288 VPHEHYNQPHEDIRAPPAELSMAP--------------PPPRSVSQETFRISTRKHSNLITVPIQ 338

  Fly   369 RINNANAQEC-------------HQGKASL---HHTL-------------------------KKG 392
            ..:|:.|:|.             :||:..:   ||.:                         ..|
Human   339 DDSNSGAREPPPPAPAPAHHHPEYQGQPVVSHPHHIMPPQQHYAPPPPPPPPISHPMPHPPQAAG 403

  Fly   393 TPHQSESVADASYYSS-----------VLASFGSAAGNPGSGPP---GGGATAAAQPA---NPSG 440
            |||...|.|.....:|           ::|.......:|..|||   .||....|.|.   ||:.
Human   404 TPHLVYSQAPPPPMTSAPPPITPPPGHIIAQMPPYMNHPPPGPPPPQHGGPPVTAPPPHHYNPNS 468

  Fly   441 -----------SHSAVGPGALIGGSTDAPTG 460
                       |.....||.:..|...||.|
Human   469 LPQFTEDQGTLSPPFTQPGGMSPGIWPAPRG 499

Known Domains:


GeneSequenceDomainRegion External IDIdentity
HakaiNP_001260593.1 RING-HC_HAKAI_like 178..216 CDD:319422 23/41 (56%)
RING-HC finger (C3HC4-type) 180..216 CDD:319422 22/39 (56%)
CBLL1XP_016868132.1 zf-C3HC4_2 149..188 CDD:290634 22/39 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C163179539
eggNOG 1 0.900 E1_KOG2932
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S6974
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0004825
OrthoInspector 1 1.000 T608600
orthoMCL 1 0.900 OOG5_134757
Panther 1 1.100 LDO PTHR13480
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5466
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
98.770

Return to query results.
Submit another query.