DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hakai and cbll1

Sequence 1:NP_001260593.1 Gene:Hakai FlyBaseID:FBgn0032812 Length:473 Species:Drosophila melanogaster
Sequence 2:XP_012814103.1 Gene:cbll1 XenbaseID:XB-GENE-6458353 Length:504 Species:Xenopus tropicalis

Alignment Length:339 Identity:109/340 (32%)
Similarity:140/340 (41%) Gaps:83/340 (24%)


  Fly   161 WNHKVSLIGEKVLNPMIHCCDQCDKPILVYGRMIPCKHVFCLKCA-----RAEPIKSCP------ 214
            |:.|::|||||...| ||.||:|..||.:||||||||||||..||     :|:  |.||      
 Frog    91 WDFKLNLIGEKEDTP-IHFCDKCGLPIKIYGRMIPCKHVFCYDCALMHEKKAD--KLCPGTLVEE 152

  Fly   215 --------RCTDKVLRVEQSGLGTVFMCTHGGSRYGSSGCRRTYLSQRDLQAHINHRHV------ 265
                    .|.|.|.|:||...|::|||:.      ..||:|||||||||||||||||:      
 Frog   153 STDTFKRMSCNDPVQRIEQCARGSLFMCSI------VQGCKRTYLSQRDLQAHINHRHMRATKPT 211

  Fly   266 -APQPPPLQPQPQLSAMAEQPKMTDLGGVGLGLELHKQRKLSESSVPISVSASIASRPVLSRLP- 328
             .|||.|:.| |.....||.|...          :....|...|.:| .....:...|.:..:| 
 Frog   212 ARPQPEPIHP-PLAPPQAEIPDRF----------IMPPDKHHLSHMP-PKQHILMPPPPMQHVPH 264

  Fly   329 ---------LTGGVGNIGSIGSIPPPGSAAAAQNAIH---GGHSTLTLANLTRINNANAQECHQG 381
                     :......|    |:.||...:..|:|..   ..||.|....:...:|:.|:|..|.
 Frog   265 EHFSQQHDDIRPSPAEI----SLAPPPPRSVNQDAFRISTRQHSNLITVPIQDDSNSGARETPQA 325

  Fly   382 KA-SLHHTLKKGTP---HQSESVADASYY----------SSVLASFGSAAGNP----GSGPPGGG 428
            .. :|||....|.|   |....:....:|          |..:.....|||.|    ..||| ..
 Frog   326 PGPTLHHPEYPGQPVVAHPHHIMPPQQHYAPPPPPPPPISHPMQHPPQAAGTPHMVYSQGPP-PP 389

  Fly   429 ATAAAQPANPSGSH 442
            .|.|..|..|...|
 Frog   390 MTTAPPPITPPPGH 403

Known Domains:


GeneSequenceDomainRegion External IDIdentity
HakaiNP_001260593.1 RING-HC_HAKAI_like 178..216 CDD:319422 24/57 (42%)
RING-HC finger (C3HC4-type) 180..216 CDD:319422 23/55 (42%)
cbll1XP_012814103.1 zf-C3HC4_2 109..146 CDD:290634 22/39 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C163179075
eggNOG 1 0.900 E1_KOG2932
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0004825
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
43.790

Return to query results.
Submit another query.