DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Hakai and LOC100002706

Sequence 1:NP_001260593.1 Gene:Hakai FlyBaseID:FBgn0032812 Length:473 Species:Drosophila melanogaster
Sequence 2:XP_005163097.1 Gene:LOC100002706 ID: Length:460 Species:Danio rerio

Alignment Length:487 Identity:128/488 (26%)
Similarity:166/488 (34%) Gaps:151/488 (31%)


  Fly    64 DSVMQELDKDGELETPGALE--EPLPHGALGAVAASGN-----MTPATQQPQVLQQVPPPVMSQT 121
            |:.:|..|..|.|   |.|:  ..:|...|......|.     ..|||:.|...::.|.....:.
Zfish     5 DNDLQGTDGSGSL---GGLDVRRQIPIKLLSKQTMRGKPPAQPQRPATRLPSKREEEPFRYKQEE 66

  Fly   122 TISLSLARAVDMEADISQLEAPTFTTLSRGPPEPMLRLKWNHKVSLIGEKVLNPMIHCCDQCDKP 186
            ........|....               |..|.|:.   |::|::|:|.|...| :|.||:|..|
Zfish    67 RFECKSGDAYGSH---------------RRFPHPIF---WDYKLNLVGVKDDTP-VHFCDKCGLP 112

  Fly   187 ILVYGRMIPCKHVFCLKCA---RAEPIKSCP-----RCTDKVLRVEQSGLGTVFMCTHGGSRYGS 243
            |.:||||||||||||..||   ..:..|.||     .|||.|.|:||...|::|||..      .
Zfish   113 IKIYGRMIPCKHVFCYDCAVYYEKKCDKMCPGLSLYSCTDPVQRIEQCQRGSLFMCNI------V 171

  Fly   244 SGCRRTYLSQRDLQAHINHRHV------------------------APQPP------PLQPQPQL 278
            .||:|||||||||||||||||:                        .|.||      ||.|.|..
Zfish   172 QGCKRTYLSQRDLQAHINHRHMKASKTESSRPDPSLWGSDPSDRFRLPPPPHLTKSHPLIPPPLQ 236

  Fly   279 --SAMAEQP--KMTDLGGVGLGLELHKQRKLSESSVPISVSASIASRPVLSRLPLTGGVGNIGSI 339
              .|....|  ..:|||        ...|.|...:..|: :.|......|..:|:....|:.|.:
Zfish   237 GHDAFNHPPPASPSDLG--------PSPRSLPPETFRIA-TLSTRKHSNLITVPIHDDSGSSGLL 292

  Fly   340 GSIPPPGSAA-------AAQNAIHGGHSTLTLANLTRINNANAQECHQGK----------ASLHH 387
            ....|||...       .:|..:...|..:          ...|:.|.|.          ...|.
Zfish   293 HPHTPPGPPPHHHSGDYPSQPVVSHPHHIM----------PPLQQPHYGPPPPPPPPLSIPMQHP 347

  Fly   388 TLKKGTPHQSESVADASYYSSVLASFGSAAGNPGSGPPGGGATAAAQPANPSGSHSAVGP----- 447
            .....|||.        .|:.         ..|.|.||..|...:..|  |..:|...||     
Zfish   348 PQGSATPHM--------IYNQ---------PPPMSTPPPPGHIISPMP--PFMNHPPPGPIPPVS 393

  Fly   448 -------------GALIGGSTDAPTGGSSGNW 466
                         |.| ......|.|.|.|.|
Zfish   394 PHHYNPNSMPQDQGTL-SPPFSQPGGMSPGIW 424

Known Domains:


GeneSequenceDomainRegion External IDIdentity
HakaiNP_001260593.1 RING-HC_HAKAI_like 178..216 CDD:319422 23/46 (50%)
RING-HC finger (C3HC4-type) 180..216 CDD:319422 22/44 (50%)
LOC100002706XP_005163097.1 zf-C3HC4_2 106..143 CDD:290634 21/37 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2932
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0004825
OrthoInspector 1 1.000 T596129
orthoMCL 1 0.900 OOG5_134757
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
54.760

Return to query results.
Submit another query.