DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: ref(2)P and dtnb

Sequence 1:NP_001014491.1 Gene:ref(2)P FlyBaseID:FBgn0003231 Length:599 Species:Drosophila melanogaster
Sequence 2:XP_017945503.1 Gene:dtnb XenbaseID:XB-GENE-979789 Length:542 Species:Xenopus tropicalis

Alignment Length:254 Identity:60/255 (24%)
Similarity:79/255 (31%) Gaps:92/255 (36%)


  Fly   125 VECDGCGLAPLIGFRYKCVQCSNYDLCQKC----------------------------------- 154
            |||..|....::||||:|.||.||.|||.|                                   
 Frog   156 VECSFCRSESMMGFRYRCQQCHNYQLCQNCFWRGHANGPHSNQHQMKEHSSWKSPAKKLSHAISK 220

  Fly   155 --------ELAH----KHPE------HLMLRMPTNNGPGMVDAWFTGPGLGRRSGRRSRGHCPFQ 201
                    ||.|    :|||      |::...|..|   |.||..|....|..:..: |.|    
 Frog   221 SLGCVPSRELPHPVFPEHPEKPLDLAHIVPARPLTN---MNDALVTHISSGAPTPTK-RLH---- 277

  Fly   202 ETNQADPAGEPARDSRRERRQARRHAGVLTQFVEMMTNLPLNTTTATAPAEPQKPK--------- 257
              |.||.|.          |....||.:    .|.:..|...|....:|:...:..         
 Frog   278 --NSADTAS----------RVPDEHALI----AEYVARLRFGTRVLDSPSRLDEEHRLIARYAAR 326

  Fly   258 -AAEQTESP-PQAEPTVT--AEKAAESEAKPTEPKKVNTDQSVPRTEDPVTTPRSTQPT 312
             |||...|| |..|.:..  |.|.........|.|.....|.:.|..  :...:::|||
 Frog   327 LAAEAGNSPRPPTELSFNFDANKQQRQLIAELENKNREILQEIQRLR--LEHEQASQPT 383

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ref(2)PNP_001014491.1 PB1 6..88 CDD:295447
ZZ 121..165 CDD:278966 24/93 (26%)
UBA_SQSTM 555..593 CDD:270505
dtnbXP_017945503.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001557
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.