DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10166 and DPM1

DIOPT Version :8

Sequence 1:NP_609980.1 Gene:CG10166 / 35240 FlyBaseID:FBgn0032799 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_015509.1 Gene:DPM1 / 856313 SGDID:S000006387 Length:267 Species:Saccharomyces cerevisiae

Alignment Length:241 Identity:80/242 (33%)
Similarity:127/242 (52%) Gaps:16/242 (7%)


  Fly     7 KYSILMPTYNEKDNL-PIIIWLIVKYMKASGLEYEVIVIDDGSPDGTLDVAKDLQKIYGEDKIVL 70
            :||:::|.|:||.|: |:...|..........:.|:|.:||.|.||:::....|.......:|::
Yeast     4 EYSVIVPAYHEKLNIKPLTTRLFAGMSPEMAKKTELIFVDDNSQDGSVEEVDALAHQGYNVRIIV 68

  Fly    71 RPRGSKLGLGTAYIHGIKHATGDFIVIIDADLSHHPKFIPEFIKLQQEGNYDIVSGTRYAGNGGV 135
            |.  ::.||.:|.:.|...|.|.::|.:||||.|.|:.:|:..:...:..:.:  |||||...|:
Yeast    69 RT--NERGLSSAVLKGFYEAKGQYLVCMDADLQHPPETVPKLFESLHDHAFTL--GTRYAPGVGI 129

  Fly   136 -FGWDFKRKLISRGANFLSQVLLRPNASD-LTGSFRLYKKDVLEKCIASCV-SKGYVFQMEMLVR 197
             ..|...|::||..|..:::.|  ..||| ::|.|.|.|| .||.|....: |:|:...:|:|.:
Yeast   130 DKDWPMYRRVISSTARMMARPL--TIASDPMSGFFGLQKK-YLENCNPRDINSQGFKIALELLAK 191

  Fly   198 ---ARQHGYTIAEVPITFVDRIYGTSKLGGTEIIQFAKNL--LYLF 238
               .|.....|.|||.||..|..|.|||.|..|||:.:.|  ||:|
Yeast   192 LPLPRDPRVAIGEVPFTFGVRTEGESKLSGKVIIQYLQQLKELYVF 237

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10166NP_609980.1 PLN02726 3..241 CDD:215385 80/242 (33%)
DPM1_like 10..237 CDD:133062 77/236 (33%)
DPM1NP_015509.1 DPM1_like 7..234 CDD:133062 75/234 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C170058603
eggNOG 1 0.900 E1_COG0463
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 103 1.000 Inparanoid score I1418
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0004282
OrthoInspector 1 1.000 T1136414
orthoMCL 1 0.900 OOG5_127079
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4337
TreeFam 1 0.960
1110.690

Return to query results.
Submit another query.