DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10166 and DPMS1

DIOPT Version :8

Sequence 1:NP_609980.1 Gene:CG10166 / 35240 FlyBaseID:FBgn0032799 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_564118.1 Gene:DPMS1 / 838646 AraportID:AT1G20575 Length:246 Species:Arabidopsis thaliana

Alignment Length:244 Identity:158/245 (64%)
Similarity:197/245 (80%) Gaps:5/245 (2%)


  Fly     1 MPTNG---HKYSILMPTYNEKDNLPIIIWLIVKYMKASGLEYEVIVIDDGSPDGTLDVAKDLQKI 62
            |.|.|   :||||::|||||:.|:.||::||.|:::  .:::|:||:||||||||.::.|.||::
plant     5 METKGEKKYKYSIIIPTYNERLNIAIIVYLIFKHLR--DVDFEIIVVDDGSPDGTQEIVKQLQQL 67

  Fly    63 YGEDKIVLRPRGSKLGLGTAYIHGIKHATGDFIVIIDADLSHHPKFIPEFIKLQQEGNYDIVSGT 127
            ||||:|:||.|..|||||||||||:|||||||:||:|||||||||::|.|||.|.|.|..||:||
plant    68 YGEDRILLRARAKKLGLGTAYIHGLKHATGDFVVIMDADLSHHPKYLPSFIKKQLETNASIVTGT 132

  Fly   128 RYAGNGGVFGWDFKRKLISRGANFLSQVLLRPNASDLTGSFRLYKKDVLEKCIASCVSKGYVFQM 192
            ||...|||.||:..|||.|||||.|:|.||.|..||||||||||||..||..|:|||||||||||
plant   133 RYVKGGGVHGWNLMRKLTSRGANVLAQTLLWPGVSDLTGSFRLYKKSALEDVISSCVSKGYVFQM 197

  Fly   193 EMLVRARQHGYTIAEVPITFVDRIYGTSKLGGTEIIQFAKNLLYLFATT 241
            ||:|||.:.||.|.|||||||||::|||||||:||:::.|.|:||..||
plant   198 EMIVRATRKGYHIEEVPITFVDRVFGTSKLGGSEIVEYLKGLVYLLLTT 246

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10166NP_609980.1 PLN02726 3..241 CDD:215385 156/241 (65%)
DPM1_like 10..237 CDD:133062 149/227 (66%)
DPMS1NP_564118.1 PLN02726 5..246 CDD:215385 157/243 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H2865
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1445102at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_127079
Panther 1 1.100 LDO PTHR43398
Phylome 1 0.910 0.667 Consistency score
76.930

Return to query results.
Submit another query.