DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10166 and CSLA11

DIOPT Version :8

Sequence 1:NP_609980.1 Gene:CG10166 / 35240 FlyBaseID:FBgn0032799 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_001330941.1 Gene:CSLA11 / 831477 AraportID:AT5G16190 Length:537 Species:Arabidopsis thaliana

Alignment Length:259 Identity:50/260 (19%)
Similarity:92/260 (35%) Gaps:90/260 (35%)


  Fly    10 ILMPTYNEKDNLPI-------IIW----LIVKYMKASGLEYEVIVIDDGSPDGTLDVAKDLQKIY 63
            :.:|.|||::...:       :||    |||:            |:||.:....:::.......:
plant    78 VQIPMYNEREVFKLSIGAACRLIWPLDRLIVQ------------VLDDSTDPTIMEMVSTECGKW 130

  Fly    64 GEDKIVLR------PRGSKLGLGTAYIHGIKHA---TGDFIVIIDADLSHHPKFI---------- 109
            ....|.::      ..|.|.|   |...|::|:   |..:|.|.|||....|.::          
plant   131 ATKGINIKCERRDNRNGYKAG---ALKQGMRHSYVKTCTYIAIFDADFQPEPDYLERTVPFLIHN 192

  Fly   110 PEFIKLQQEGNYDIVSGTRYAGNGGVFGWDF---KRKLISRGANFLSQVLLRPN--ASDLTGSFR 169
            ||...:|..                   |.|   |:.|::|    :.::.|..:  |...:||.|
plant   193 PELALVQAR-------------------WKFVNAKKCLMTR----MQEMSLNYHFTAEQESGSTR 234

  Fly   170 -----------LYKKDVLEKCIASCVSKGYVFQMEMLVRARQHGYTIAEVPITFVDRIYGTSKL 222
                       :::...:|:. .....:..|..|::.||...||:     ...||:.:...|:|
plant   235 HAFFGFNGTAGVWRLAAMEEA-GGWKDRTTVEDMDLAVRVGLHGW-----KFVFVNDVSVKSEL 292

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10166NP_609980.1 PLN02726 3..241 CDD:215385 50/260 (19%)
DPM1_like 10..237 CDD:133062 50/260 (19%)
CSLA11NP_001330941.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
10.910

Return to query results.
Submit another query.