DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10166 and CSLC12

DIOPT Version :9

Sequence 1:NP_609980.1 Gene:CG10166 / 35240 FlyBaseID:FBgn0032799 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_001328773.1 Gene:CSLC12 / 826301 AraportID:AT4G07960 Length:699 Species:Arabidopsis thaliana


Alignment Length:235 Identity:53/235 - (22%)
Similarity:85/235 - (36%) Gaps:75/235 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 ILMPTYNEKD----------NLPIIIWLIVKYMKASGLEYEVIVIDDGSPDGTLDVAKD----LQ 60
            :.:|..|||:          ||.   |...|.:        :.::||.....|..:.|:    .|
plant   245 VQIPMCNEKEVYQQSIAAVCNLD---WPKGKIL--------IQILDDSDDPITQSLIKEEVHKWQ 298

  Fly    61 KIYGEDKIVLRPR----GSKLG-----LGTAYIHGIKHATGDFIVIIDADLSHHPKF----IPEF 112
            |:..  :||.|.|    |.|.|     :..:|:...     :|:.|.|||....|.|    ||.|
plant   299 KLGA--RIVYRHRVNREGYKAGNLKSAMNCSYVKDY-----EFVAIFDADFQPLPDFLKKTIPHF 356

  Fly   113 IKLQQEGNYDIVSGTRYAGNGGVFGWDFKRK---LISRGANF-----------LSQVLLRPNASD 163
            ...::.|   :|...          |.|..|   |::|..|.           ::.|.|  |...
plant   357 KDNEEIG---LVQAR----------WSFVNKEENLLTRLQNINLAFHFEVEQQVNSVFL--NFFG 406

  Fly   164 LTGSFRLYKKDVLEKCIASCVSKGYVFQMEMLVRARQHGY 203
            ..|:..:::...||.. ...:.:..|..|::.|||..||:
plant   407 FNGTAGVWRIKALEDS-GGWLERTTVEDMDIAVRAHLHGW 445

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10166NP_609980.1 PLN02726 3..241 CDD:215385 53/235 (23%)
DPM1_like 10..237 CDD:133062 53/235 (23%)
CSLC12NP_001328773.1 Glyco_tranf_GTA_type 241..477 CDD:416254 53/235 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.