DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10166 and CSLC12

DIOPT Version :8

Sequence 1:NP_609980.1 Gene:CG10166 / 35240 FlyBaseID:FBgn0032799 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_001328773.1 Gene:CSLC12 / 826301 AraportID:AT4G07960 Length:699 Species:Arabidopsis thaliana

Alignment Length:235 Identity:53/236 (22%)
Similarity:85/236 (36%) Gaps:75/236 (32%)


  Fly    10 ILMPTYNEKD----------NLPIIIWLIVKYMKASGLEYEVIVIDDGSPDGTLDVAKD----LQ 60
            :.:|..|||:          ||.   |...|.:        :.::||.....|..:.|:    .|
plant   245 VQIPMCNEKEVYQQSIAAVCNLD---WPKGKIL--------IQILDDSDDPITQSLIKEEVHKWQ 298

  Fly    61 KIYGEDKIVLRPR----GSKLG-----LGTAYIHGIKHATGDFIVIIDADLSHHPKF----IPEF 112
            |:..  :||.|.|    |.|.|     :..:|:...     :|:.|.|||....|.|    ||.|
plant   299 KLGA--RIVYRHRVNREGYKAGNLKSAMNCSYVKDY-----EFVAIFDADFQPLPDFLKKTIPHF 356

  Fly   113 IKLQQEGNYDIVSGTRYAGNGGVFGWDFKRK---LISRGANF-----------LSQVLLRPNASD 163
            ...::.|   :|...          |.|..|   |::|..|.           ::.|.|  |...
plant   357 KDNEEIG---LVQAR----------WSFVNKEENLLTRLQNINLAFHFEVEQQVNSVFL--NFFG 406

  Fly   164 LTGSFRLYKKDVLEKCIASCVSKGYVFQMEMLVRARQHGY 203
            ..|:..:::...||.. ...:.:..|..|::.|||..||:
plant   407 FNGTAGVWRIKALEDS-GGWLERTTVEDMDIAVRAHLHGW 445

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10166NP_609980.1 PLN02726 3..241 CDD:215385 53/236 (22%)
DPM1_like 10..237 CDD:133062 53/236 (22%)
CSLC12NP_001328773.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
10.910

Return to query results.
Submit another query.