DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10166 and alg5

DIOPT Version :8

Sequence 1:NP_609980.1 Gene:CG10166 / 35240 FlyBaseID:FBgn0032799 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_001006780.1 Gene:alg5 / 448472 XenbaseID:XB-GENE-946754 Length:324 Species:Xenopus tropicalis

Alignment Length:249 Identity:66/250 (26%)
Similarity:111/250 (44%) Gaps:30/250 (12%)


  Fly     9 SILMPTYNEKDNLPIII-----WLIVKYMKASGLEYEVIVIDDGSPDGTLDVAKDLQKIYGEDKI 68
            |:::|:|||::.||:::     :|..:..|.....|||||:||||.|.|.:||....|.||.||:
 Frog    68 SVVVPSYNEEERLPVMMDEAMEFLEQRQKKQPSFNYEVIVVDDGSRDKTTEVAFKYCKKYGSDKV 132

  Fly    69 VLRPRGSKLGLGTAYIHGIKHATGDFIVIIDADLSHHPKFIPEFIKLQQEG---------NYDIV 124
            .:.......|.|.|...|:..:.|..|::.|||.:  .||..  ||..:.|         ...|.
 Frog   133 RVLTLKKNRGKGGAVRMGVLVSRGKLILMADADGA--TKFAD--IKNVEVGLEKLKPWPDQMAIS 193

  Fly   125 SGTR------YAGNGGVFGWDFKRKLISRGANFLSQVLLRPNASDLTGSFRLYKKDVLEKCIASC 183
            .|:|      ......||     |..:..|.:||...|......|....|:|..::...:..::.
 Frog   194 CGSRAHLEKDSIAQRSVF-----RTFLMYGFHFLVWFLCVRRVKDTQCGFKLLTREAAARTFSAL 253

  Fly   184 VSKGYVFQMEMLVRARQHGYTIAEVPITFVDRIYGTSKLGGTEIIQFAKNLLYL 237
            ....:.|.:|:|..|:.....:|||.:.:.: |.|:..:.....:|..::||::
 Frog   254 HVDRWAFDVELLYIAQCLSIPVAEVAVNWTE-IEGSKLVPFWSWLQMGRDLLFI 306

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10166NP_609980.1 PLN02726 3..241 CDD:215385 66/250 (26%)
DPM1_like 10..237 CDD:133062 65/247 (26%)
alg5NP_001006780.1 PRK10714 32..323 CDD:330928 66/250 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG0463
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.