DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10166 and Dpm1

DIOPT Version :8

Sequence 1:NP_609980.1 Gene:CG10166 / 35240 FlyBaseID:FBgn0032799 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_001100014.1 Gene:Dpm1 / 296394 RGDID:1310120 Length:260 Species:Rattus norvegicus

Alignment Length:235 Identity:172/236 (73%)
Similarity:208/236 (88%) Gaps:0/236 (0%)


  Fly     7 KYSILMPTYNEKDNLPIIIWLIVKYMKASGLEYEVIVIDDGSPDGTLDVAKDLQKIYGEDKIVLR 71
            |||:|:|||||::|||:|:||:||....|.:.||:|:|||||||||.:||:.|:||||.|:|:||
  Rat    26 KYSVLLPTYNERENLPLIVWLLVKSFSESAINYEIIIIDDGSPDGTREVAEQLEKIYGPDRILLR 90

  Fly    72 PRGSKLGLGTAYIHGIKHATGDFIVIIDADLSHHPKFIPEFIKLQQEGNYDIVSGTRYAGNGGVF 136
            ||..|||||||||||||||||::::|:|||||||||||||||:.|:|||:||||||||.|||||:
  Rat    91 PREKKLGLGTAYIHGIKHATGNYVIIMDADLSHHPKFIPEFIRKQKEGNFDIVSGTRYKGNGGVY 155

  Fly   137 GWDFKRKLISRGANFLSQVLLRPNASDLTGSFRLYKKDVLEKCIASCVSKGYVFQMEMLVRARQH 201
            |||.|||:|||||||::|:||||.|||||||||||:|:||:|.|..||||||||||||:|||||.
  Rat   156 GWDLKRKIISRGANFITQILLRPGASDLTGSFRLYRKEVLQKLIEKCVSKGYVFQMEMIVRARQM 220

  Fly   202 GYTIAEVPITFVDRIYGTSKLGGTEIIQFAKNLLYLFATT 241
            .||:.||||:||||:||.|||||.||:.|.|.||.|||||
  Rat   221 DYTVGEVPISFVDRVYGESKLGGNEIVSFLKGLLTLFATT 260

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10166NP_609980.1 PLN02726 3..241 CDD:215385 171/234 (73%)
DPM1_like 10..237 CDD:133062 164/227 (72%)
Dpm1NP_001100014.1 PLN02726 21..260 CDD:215385 171/234 (73%)
DPM1_like 29..256 CDD:133062 164/227 (72%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C170052329
eggNOG 1 0.900 E1_COG0463
Hieranoid 1 1.000
Homologene 1 1.000 H2865
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1445102at2759
OrthoFinder 1 1.000 FOG0004282
OrthoInspector 1 1.000 T1087869
orthoMCL 1 0.900 OOG5_127079
Panther 1 1.100 LDO PTHR43398
Phylome 1 0.910 0.667 Consistency score
TreeFam 1 0.960
1211.720

Return to query results.
Submit another query.