DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10166 and dpm-1

DIOPT Version :8

Sequence 1:NP_609980.1 Gene:CG10166 / 35240 FlyBaseID:FBgn0032799 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_499931.2 Gene:dpm-1 / 176874 WormBaseID:WBGene00022044 Length:239 Species:Caenorhabditis elegans

Alignment Length:237 Identity:155/238 (65%)
Similarity:187/238 (79%) Gaps:2/238 (1%)


  Fly     3 TNGHKYSILMPTYNEKDNLPIIIWLIVKYMKASGLEYEVIVIDDGSPDGTLDVAKDLQKIYGEDK 67
            |:..||||::||||||:||||.||||..|:|.  :.:|||::||.|||||..:||.|||.||:||
 Worm     2 TSTPKYSIILPTYNEKENLPICIWLIENYLKE--VSHEVIIVDDASPDGTQGIAKLLQKEYGDDK 64

  Fly    68 IVLRPRGSKLGLGTAYIHGIKHATGDFIVIIDADLSHHPKFIPEFIKLQQEGNYDIVSGTRYAGN 132
            |:::||..||||||||.||:..|.|:||:::|||||||||||||.|.||.:...|||:||||...
 Worm    65 ILIKPRVGKLGLGTAYSHGLSFARGEFIILMDADLSHHPKFIPEMIALQHKYKLDIVTGTRYKDG 129

  Fly   133 GGVFGWDFKRKLISRGANFLSQVLLRPNASDLTGSFRLYKKDVLEKCIASCVSKGYVFQMEMLVR 197
            |||.|||.|||.||:|||||:|.||.|..|||||||||||:|:|.|.||..|||||||||||:.|
 Worm   130 GGVSGWDLKRKTISKGANFLAQFLLNPGVSDLTGSFRLYKRDILSKLIAESVSKGYVFQMEMMFR 194

  Fly   198 ARQHGYTIAEVPITFVDRIYGTSKLGGTEIIQFAKNLLYLFA 239
            |::.||.|.||||:||||.:|.||||..||:.:||.||||||
 Worm   195 AKKSGYRIGEVPISFVDRFFGESKLGSQEIVDYAKGLLYLFA 236

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG10166NP_609980.1 PLN02726 3..241 CDD:215385 155/238 (65%)
DPM1_like 10..237 CDD:133062 148/227 (65%)
dpm-1NP_499931.2 PLN02726 1..235 CDD:215385 153/235 (65%)
DPM1_like 9..234 CDD:133062 148/227 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C170043458
eggNOG 1 0.900 E1_COG0463
Hieranoid 1 1.000
Homologene 1 1.000 H2865
Inparanoid 1 1.050 321 1.000 Inparanoid score I1474
Isobase 1 0.950 0.830698 Normalized mean entropy S787
OMA 1 1.010
OrthoDB 1 1.010 D1445102at2759
OrthoFinder 1 1.000 FOG0004282
OrthoInspector 1 1.000 T474445
orthoMCL 1 0.900 OOG5_127079
Panther 1 1.100 LDO PTHR43398
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4337
TreeFam 00.000 Not matched by this tool.
1413.790

Return to query results.
Submit another query.