DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10166 and dpm-1

DIOPT Version :9

Sequence 1:NP_609980.1 Gene:CG10166 / 35240 FlyBaseID:FBgn0032799 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_499931.2 Gene:dpm-1 / 176874 WormBaseID:WBGene00022044 Length:239 Species:Caenorhabditis elegans


Alignment Length:237 Identity:155/237 - (65%)
Similarity:187/237 - (78%) Gaps:2/237 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 TNGHKYSILMPTYNEKDNLPIIIWLIVKYMKASGLEYEVIVIDDGSPDGTLDVAKDLQKIYGEDK 67
            |:..||||::||||||:||||.||||..|:|.  :.:|||::||.|||||..:||.|||.||:||
 Worm     2 TSTPKYSIILPTYNEKENLPICIWLIENYLKE--VSHEVIIVDDASPDGTQGIAKLLQKEYGDDK 64

  Fly    68 IVLRPRGSKLGLGTAYIHGIKHATGDFIVIIDADLSHHPKFIPEFIKLQQEGNYDIVSGTRYAGN 132
            |:::||..||||||||.||:..|.|:||:::|||||||||||||.|.||.:...|||:||||...
 Worm    65 ILIKPRVGKLGLGTAYSHGLSFARGEFIILMDADLSHHPKFIPEMIALQHKYKLDIVTGTRYKDG 129

  Fly   133 GGVFGWDFKRKLISRGANFLSQVLLRPNASDLTGSFRLYKKDVLEKCIASCVSKGYVFQMEMLVR 197
            |||.|||.|||.||:|||||:|.||.|..|||||||||||:|:|.|.||..|||||||||||:.|
 Worm   130 GGVSGWDLKRKTISKGANFLAQFLLNPGVSDLTGSFRLYKRDILSKLIAESVSKGYVFQMEMMFR 194

  Fly   198 ARQHGYTIAEVPITFVDRIYGTSKLGGTEIIQFAKNLLYLFA 239
            |::.||.|.||||:||||.:|.||||..||:.:||.||||||
 Worm   195 AKKSGYRIGEVPISFVDRFFGESKLGSQEIVDYAKGLLYLFA 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10166NP_609980.1 PLN02726 3..241 CDD:215385 155/237 (65%)
DPM1_like 10..237 CDD:133062 147/226 (65%)
dpm-1NP_499931.2 PLN02726 1..235 CDD:215385 152/234 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160159574
Domainoid 1 1.000 234 1.000 Domainoid score I1345
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H2865
Inparanoid 1 1.050 321 1.000 Inparanoid score I1490
Isobase 1 0.950 - 0.830698 Normalized mean entropy S787
OMA 1 1.010 - - QHG61609
OrthoDB 1 1.010 - - D1445102at2759
OrthoFinder 1 1.000 - - FOG0003124
OrthoInspector 1 1.000 - - oto20054
orthoMCL 1 0.900 - - OOG6_100818
Panther 1 1.100 - - LDO PTHR43398
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4337
SonicParanoid 1 1.000 - - X2989
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1615.890

Return to query results.
Submit another query.