DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: swm and AT3G27700

Sequence 1:NP_001260586.1 Gene:swm FlyBaseID:FBgn0002044 Length:1063 Species:Drosophila melanogaster
Sequence 2:NP_189407.2 Gene:AT3G27700 AraportID:AT3G27700 Length:908 Species:Arabidopsis thaliana

Alignment Length:1040 Identity:229/1041 (22%)
Similarity:365/1041 (35%) Gaps:373/1041 (36%)


  Fly   226 ADKENQPRDSRRRRASLRSRSRSRS---RSNERAFRRSRSRDRRVNEREKTQRQFRNKSPPGSQT 287
            :::|:..|:.:.||   :..:||:|   .|:::||    ||..|     |..|.:.|    |:..
plant    29 SEEEDDDRNHKHRR---KEETRSQSLEQDSSDQAF----SRPYR-----KNYRHYEN----GNSF 77

  Fly   288 DNRHHGRRNFDRRRIGGNADDRPRFGNNKSRRS--HSRSMSP-----------ERNARRN----- 334
            .  .|.:|:|     |..:..|.:|.|.:.|.:  .||...|           :|::|.|     
plant    78 S--EHEKRSF-----GTGSGQRVQFDNQRMRSNPMFSRDSGPGRGRGNYGSWAQRDSRFNPVDLS 135

  Fly   335 -------------------------QNSP---------------DRVQTAQANLIPAPVAPPAPV 359
                                     |::|               |.....|.:|.|       |:
plant   136 SHMVQVGSMGQGMFGGRGLAGVSAAQSAPWPPFGMIPGVPNGGLDGFHHLQGSLRP-------PL 193

  Fly   360 EHPASH--PRQRCRDFDEKGYCVRGETCPWDHGVNPVVFEGINNTSLMMSMREYN-----PDAPE 417
            ..|.:.  ||||||||:|:|:|:||:.||.:||:|.:|.:.:      .|:.::|     |.||.
plant   194 NAPLNMGIPRQRCRDFEERGFCLRGDMCPMEHGMNRIVVDDV------QSLSQFNLPVSVPGAPH 252

  Fly   418 IWARS-------GGP----PPGA--------------GQGPVPP---------PTQP------GQ 442
            :.|.|       ||.    |.||              |.|...|         |.||      |:
plant   253 LAASSKQVPAQFGGASFMNPKGAHGRTNEGGMAVDGLGYGDAYPSAGGTDFYDPDQPLWNNSTGE 317

  Fly   443 T-----TINP--FSGNVRP------TTLMSGSGPSPMGVPNPADYARNPGAPPQA-------AMM 487
            |     |:|.  ...||.|      ....:|.|.......:.:.:.|..|:..||       |::
plant   318 TSGAISTLNSHGVDENVAPLDDSNQDAAENGCGIRDSRSTSQSVWGRMKGSNSQANSKEKADAVL 382

  Fly   488 PFPFNPTAVTTPLQRQLIPIPVVDGAPTGGVAEVGKRRFELEDTVAIADVPTKRKVPINSRLGPR 552
                |.:||.   :.||..:.|       ..:..||:....|....:.|         :|.:.  
plant   383 ----NSSAVP---EDQLKEVSV-------NSSRHGKQNHVGESVAKVVD---------SSNIS-- 422

  Fly   553 VNPNMQQHNSSLELRKVPRGL--NTIAHLNN-------HFAKFGKIVNIQVSYEGDPEAAIVTFS 608
               |...:|:....:|..|.|  |.:.|.:|       ||.||||:::|.:..  :.|.|.|.||
plant   423 ---NDMMNNTRKPTQKAMRTLFVNYVPHESNRRDLILAHFQKFGKVIDIHIPV--NSERAFVQFS 482

  Fly   609 THAEANVAYRSTEAVLNNRFIKVFWHNDSSGADVGQMNQMGGGGGGGGRKNASQYHLHNVPAVPT 673
            ...||..|.|:.:||:.|||||::|.|..|..|.|...     |.|...|..|.           
plant   483 KREEAESALRAPDAVMGNRFIKLWWANRDSIPDNGLST-----GSGASMKGRSM----------- 531

  Fly   674 PNADGAKISNANPLTEAGAGNIGTPATEQANTAAPASMRLKLNTTTAGGSAGGAAGAGAPGSG-- 736
             .|.||:  |..|:..|...|             ..|...|:.|...|         |||.|.  
plant   532 -TASGAQ--NQFPIAAASKSN-------------HVSSIAKVPTFQTG---------GAPSSSEQ 571

  Fly   737 -RPLNPAANAASIRKKQEEQQKAVHQLANGLRKRKQELLQSYMKQMKTALELVERMDQQDPQRAP 800
             :|:....:...:...|:::...:.:|...||| |||:|:....:.:..|..:|:          
plant   572 PKPVVVTTSGPKVTPLQQKKADTLERLKETLRK-KQEMLEQKRNEYRKKLATLEK---------- 625

  Fly   801 TLQTIKVLQMTIDKLRKEIKADQDQLQAQMQQQQQQQQPPVKKTKEQQKKELLDMELELIAQQQE 865
                                      |..:.::::..:|..|:.|       ||...:..|....
plant   626 --------------------------QGTVVKREEADEPDAKRVK-------LDTASDSGAAIAS 657

  Fly   866 GNDTTAIQKRLEELQRNLGVGSAANNKSTHYAPASGAPGGGAGRKRP-------NLP-EGPTRVD 922
            ....::..|::..|:      ..:..|.:...|   :|.....::||       |.| ....::|
plant   658 PKTESSTDKKVPILK------PLSTAKLSTETP---SPDSKNFKQRPYSFTTSLNAPMVNRYKLD 713

  Fly   923 RRPKAIVV-----TGFAAEEADFVLGHFKNFGEISK--------------HDVDREIPQLILSYA 968
            .|...|.|     ||.|  :...|..||.::||:||              |:...|.....:::.
plant   714 NRTTTIKVVPPLPTGLA--DVAVVKEHFSSYGEVSKVELEDNASIDSGKDHETQNESRAACVTFV 776

  Fly   969 TRLNAEQAVLRGKMYKDKRLQISW-------------------------------APVVTPAPAP 1002
            .|..||:|....|.:::..||:.|                               ...|:..|.|
plant   777 KRSAAEKAFANAKCWQEHTLQLVWVTRQSNRESNNNNNNSNSLSVSRDNLSSKNKCASVSNDPKP 841

  Fly  1003 MAAPVEKSAA--PGDMSVSLENPKQL-IQSVSES---------ESLLGSDTLPELRLEDEEEDEE 1055
             |..|:.|:.  |.:.:||.:|...| .|...||         ||:.|:..:......|||:.|:
plant   842 -AVEVKTSSTEEPENTNVSGDNDSTLDKQETKESDNDNNKSNHESIEGASEVIATAGTDEEQSEQ 905

  Fly  1056  1055
            plant   906  905

Known Domains:


GeneSequenceDomainRegion External IDIdentity
swmNP_001260586.1 RRM1_RBM26_like 561..634 CDD:240703 31/82 (38%)
RRM2_RBM26_like 921..992 CDD:240704 23/90 (26%)
AT3G27700NP_189407.2 ZnF_C3H1 <206..227 CDD:214632 13/21 (62%)
RRM 365..>493 CDD:223796 39/158 (25%)
RRM1_RBM26_like 437..508 CDD:240703 29/73 (40%)
RRM_SF 712..800 CDD:302621 23/90 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 93 1.000 Inparanoid score I2178
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T192512
orthoMCL 1 0.900 OOG5_129444
Panther 1 1.100 LDO PTHR14398
Phylome 1 0.910 0.923 Consistency score
54.960

Return to query results.
Submit another query.