DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: swm and Rbm26

Sequence 1:NP_001260586.1 Gene:swm FlyBaseID:FBgn0002044 Length:1063 Species:Drosophila melanogaster
Sequence 2:NP_001355612.1 Gene:Rbm26 MGIID:1921463 Length:1012 Species:Mus musculus

Alignment Length:1186 Identity:342/1187 (29%)
Similarity:506/1187 (43%) Gaps:301/1187 (25%)


  Fly     1 MILENSDKLKDWLSVVLEPLCDADSSALARYVIALLKKDKSDKDLKRIMIEQLDVFLSEETTRFV 65
            ||:||.:.||.|||..|||:||||.||||:||:||:|||||:|:||.:.|:||||||.:||..||
Mouse     5 MIIENFEALKSWLSKTLEPICDADPSALAKYVLALVKKDKSEKELKALCIDQLDVFLQKETQIFV 69

  Fly    66 ERLFDAIASEEYLTVPAAPLITASSASTAELTVDQELALVIDGPQDDIEAVLVADSPPPPPKDNV 130
            |:||||:.::.||..|..|       |:..|.||     .:...:.||:            |:.:
Mouse    70 EKLFDAVNTKSYLPPPEQP-------SSGSLKVD-----FLQHQEKDIK------------KEEL 110

  Fly   131 IKPDSNQVKLEQASQDAREAEALAFISQEAGIAMHVPTDAKPAFDQHKTKDSHNQQSASNYQHHH 195
            .|.:..:.|..:...                   |.|..:...:..::::|...:...|..:.: 
Mouse   111 TKEEEREKKFSRRLN-------------------HSPPQSSSRYRDNRSRDERKKDDRSRKRDY- 155

  Fly   196 VRSASPPGRSSGVSGSGGGGPGGAGLAAGYADKENQPRDSRRRRASLRSRSRSRSRSNERAFRRS 260
              ..:||.|.|                  |.|:.|      |||...||.|||||||..:...|.
Mouse   156 --DRNPPRRDS------------------YRDRYN------RRRGRSRSYSRSRSRSWSKERLRD 194

  Fly   261 RSRDR-RVNEREKTQRQFRNKSPPGSQTDNRHHGRRNFDRRRIGGNADD---------------- 308
            |.||| |...|.:|:.:.|:...|....|.......|:.......|...                
Mouse   195 RDRDRSRTRSRSRTRSRERDLVKPKYDLDRTDPLENNYTPVSSVSNISSGHYPVPTLSSTITVIA 259

  Fly   309 RPRFGNNKSRRSHSRSMSPERNARRNQNSPDRVQTAQANLIPAPVAPPAPVEHPASHPRQRCRDF 373
            ....|||.     :.|.|.....:.:.||              .|.||.        |::||||:
Mouse   260 PTHHGNNT-----TESWSEFHEDQVDHNS--------------YVRPPM--------PKKRCRDY 297

  Fly   374 DEKGYCVRGETCPWDHGVNPVVFEGINNTSLMMSMREYNPDAPEIWARSGGPPPGAGQGPVPPPT 438
            ||||:|:||:.||:|||.:|||.|.:|    :..|..:....|.:   .|.||||.   |.||| 
Mouse   298 DEKGFCMRGDMCPFDHGSDPVVVEDVN----LPGMLPFPAQPPVV---EGPPPPGL---PPPPP- 351

  Fly   439 QPGQTTINPFSGNVRPTTLMSGSGPSPMGVPNPADYARNPGAPPQAAMMPFPFN------PTAVT 497
                 .:.|...|:||.  :...||.|..:| |......|..|.|.:.|..|.|      ||.||
Mouse   352 -----ILTPPPVNLRPP--VPPPGPLPPSLP-PVTGPPPPLPPLQPSGMDAPPNSATSSVPTVVT 408

  Fly   498 TPLQRQLIPIPV--------------VDG----AP--TGGVAEVGKRRFELED------TVAIAD 536
            |.:..|..|.|.              .||    ||  |.....:.:.|...:.      |....|
Mouse   409 TGIHHQPPPAPPSLFTAVFVLPDTYDTDGYNPEAPSITNTSRPMYRHRVHAQRPNLIGLTSGDMD 473

  Fly   537 VPTKRKVPINSRL----------------------------GPRVN----PNMQQ------HNSS 563
            :|.:.|.|..|.:                            .|..|    |..|:      .|:.
Mouse   474 LPPREKPPNKSSMRIVVDSESRKRTIGSGEPGVSTKKTWFDKPNFNRTNSPGFQKKVQFGNENTK 538

  Fly   564 LELRKVPRGLNTIAHLNNHFAKFGKIVNIQVSYEGDPEAAIVTFSTHAEANVAYRSTEAVLNNRF 628
            |||||||..||.|:.||.||::||.:||:||:|.||||.|::.|:|:.||..|..||||||||||
Mouse   539 LELRKVPPELNNISKLNEHFSRFGTLVNLQVAYNGDPEGALIQFATYEEAKKAISSTEAVLNNRF 603

  Fly   629 IKVFWHNDSSGADVGQMNQMGGGGGGGGR-----------KNASQYHLHNVPAVPTPNADGAKIS 682
            |||:||.:      |...|:........:           |.:.:..|..||:..|..|:....:
Mouse   604 IKVYWHRE------GTTQQLQTTSPKVIQPLVQQPILPVVKQSVKERLGPVPSATTEPAEAQSAT 662

  Fly   683 NANP--LTEAGA----GNIGTP---ATEQANTAA---------PASMRLKLNTTTAGGSAGGAAG 729
            :..|  :|:...    |.:..|   |||:..:.:         ||:::....|.:..        
Mouse   663 SELPQNVTKLSVKDRLGFVSKPSVSATEKVLSTSTGLTKTVYNPAALKAAQKTLSVS-------- 719

  Fly   730 AGAPGSGRPLNPAANAASIRKKQEEQQKAVHQLANGLRKRKQELLQSYMKQMKTALELVER---M 791
                      .||.:....:||::|..|    |...:||||||:|:.:::..|..:..:|:   |
Mouse   720 ----------TPAVDNNEAQKKKQEALK----LQQDVRKRKQEILEKHIETQKMLISKLEKNKTM 770

  Fly   792 DQQDPQRAPTLQTIKVLQMTIDKLRKEIKADQDQLQAQMQQQQQQQQPPVKKTKEQQKKELLDME 856
            ..:|  :|..::|:::|...|.||:.|:|:          ....:..|...|||.|.:|||||.|
Mouse   771 KSED--KAEIMKTLEILTKNITKLKDEVKS----------TSPGRCLPKSIKTKTQMQKELLDTE 823

  Fly   857 LELIAQQQEGNDTTAIQKRLEELQ---RNLGVGSAANNKSTHYAPASGAPGGGAGRKRPNLPEGP 918
            |:|..:.|.|.:.|.::::..|||   ...|:.|:...:..|......|.|.|.||.|.....|.
Mouse   824 LDLYKKMQAGEEVTELRRKYTELQLEAAKRGILSSGRGRGIHTRGRGTAHGRGRGRGRGRGVPGH 888

  Fly   919 TRVDRRPKAIVVTGFAAEEADFVLGHFKNFGEISKHDVDREIPQLILSYATRLNAEQAVLRGKMY 983
            ..||.||:|:.::.|...:.:.:|.||..:|||....:|......|:::.||..||.|.:.|..:
Mouse   889 AVVDHRPRALEISAFTESDREDLLPHFAQYGEIEDCQIDDASLHAIITFKTRAEAEAAAIHGARF 953

  Fly   984 KDKRLQISW-APVVTPAPAPMAAPVEKSAAPGDMSVSLENPKQLIQSVSESESLLGSDTLPELRL 1047
            |.:.|:::| .|:     |.|:|...:.|.|.:...             :.|||:....|.    
Mouse   954 KGQDLKLAWNKPI-----ANMSAVDTEEAEPDEEEF-------------QEESLVDDSLLQ---- 996

  Fly  1048 EDEEEDEESEDRSWRR 1063
            :|:||:|::|.|||||
Mouse   997 DDDEEEEDNESRSWRR 1012

Known Domains:


GeneSequenceDomainRegion External IDIdentity
swmNP_001260586.1 RRM1_RBM26_like 561..634 CDD:240703 46/73 (63%)
RRM2_RBM26_like 921..992 CDD:240704 22/71 (31%)
Rbm26NP_001355612.1 PWI 11..74 CDD:351805 42/63 (67%)
DUF1777 133..>165 CDD:312240 6/53 (11%)
ZnF_C3H1 <294..314 CDD:214632 14/20 (70%)
RRM1_RBM26 536..611 CDD:240960 47/75 (63%)
Mnd1 <726..>821 CDD:335556 33/111 (30%)
RRM2_RBM26_like 891..962 CDD:240704 22/71 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C334653172
eggNOG 1 0.900 E1_KOG2135
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 374 1.000 Inparanoid score I2074
Isobase 1 0.950 0 Normalized mean entropy S7344
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002051
OrthoInspector 1 1.000 T616628
orthoMCL 1 0.900 OOG5_129444
Panther 1 1.100 O PTHR14398
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3653
TreeFam 1 0.960
1312.740

Return to query results.
Submit another query.