DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: swm and RBM26

Sequence 1:NP_001260586.1 Gene:swm FlyBaseID:FBgn0002044 Length:1063 Species:Drosophila melanogaster
Sequence 2:XP_011533481.1 Gene:RBM26 HGNCID:20327 Length:1025 Species:Homo sapiens

Alignment Length:1152 Identity:329/1153 (29%)
Similarity:482/1153 (42%) Gaps:312/1153 (27%)


  Fly     1 MILENSDKLKDWLSVVLEPLCDADSSALARYVIALLKKDKSDKDLKRIMIEQLDVFLSEETTRFV 65
            ||:||.:.||.|||..|||:||||.||||:||:||:|||||:|:||.:.|:||||||.:||..||
Human     5 MIIENFEALKSWLSKTLEPICDADPSALAKYVLALVKKDKSEKELKALCIDQLDVFLQKETQIFV 69

  Fly    66 ERLFDAIASEEYLTVPAAPLITASSASTAELTVDQELALVIDGPQDDIEAVLVADSPPPPPKDNV 130
            |:||||:.::.||..|..|   :|.:...|....||         .||:            |:.:
Human    70 EKLFDAVNTKSYLPPPEQP---SSGSLKVEFFPHQE---------KDIK------------KEEI 110

  Fly   131 IKPDSNQVKLEQASQDAREAEALAFISQEAGIAMHVPTDAKPAFDQHKTKDSHNQQSASNYQHHH 195
            .|.:..:.|..:...                   |.|..:...:.:::::|...:...|..:.: 
Human   111 TKEEEREKKFSRRLN-------------------HSPPQSSSRYRENRSRDERKKDDRSRKRDY- 155

  Fly   196 VRSASPPGRSSGVSGSGGGGPGGAGLAAGYADKENQPRDSRRRRASLRSRSRSRSRSNERAFRRS 260
              ..:||.|.|                  |.|:.|      |||...||.|||||||..:...|.
Human   156 --DRNPPRRDS------------------YRDRYN------RRRGRSRSYSRSRSRSWSKERLRE 194

  Fly   261 RSRDRRVNEREKTQRQFRNKSPPGSQTDNRHHGRRNFDRRRIGGNADDRPRFGNNKSRRSHSRSM 325
            |.|||                   |:|                               ||.||:.
Human   195 RDRDR-------------------SRT-------------------------------RSRSRTR 209

  Fly   326 SPERNARRNQNSPDRVQTAQANLIPAPVAP-------PAP-------VEHPASH----------- 365
            |.||:..:.:...||....:.|..|....|       |.|       |..|..|           
Human   210 SRERDLVKPKYDLDRTDPLENNYTPVSSVPSISSGHYPVPTLSSTITVIAPTHHGNNTTESWSEF 274

  Fly   366 ---------------PRQRCRDFDEKGYCVRGETCPWDHGVNPVVFEGINNTSLMMSMREYNPDA 415
                           |::||||:||||:|:||:.||:|||.:|||.|.:|    :..|..:....
Human   275 HEDQVDHNSYVRPPMPKKRCRDYDEKGFCMRGDMCPFDHGSDPVVVEDVN----LPGMLPFPAQP 335

  Fly   416 PEIWARSGGPPPGAGQGPVPPPTQPGQTTINPFSGNVRPTTLMSGSGPSPMGVPNPAD---YA-- 475
            |.:   .|.||||.   |.|||      .:.|...|:||.  :...||.|..:|...|   |:  
Human   336 PVV---EGPPPPGL---PPPPP------ILTPPPVNLRPP--VPPPGPLPPSLPPVTDDISYSLV 386

  Fly   476 ---RNPGAPP-QAAMMPFPFN------PTAVTTPLQRQLIPIPV--------------VDG---- 512
               ..|..|| |.:.|..|.|      ||.|||.:..|..|.|.              .||    
Human   387 LTGPPPPLPPLQPSGMDAPPNSATSSVPTVVTTGIHHQPPPAPPSLFTAVFVLPDTYDTDGYNPE 451

  Fly   513 AP--TGGVAEVGKRRFELED------TVAIADVPTKRKVPINSRL-------------------- 549
            ||  |.....:.:.|...:.      |....|:|.:.|.|..|.:                    
Human   452 APSITNTSRPMYRHRVHAQRPNLIGLTSGDMDLPPREKPPNKSSMRIVVDSESRKRTIGSGEPGV 516

  Fly   550 --------GPRVN----PNMQQ------HNSSLELRKVPRGLNTIAHLNNHFAKFGKIVNIQVSY 596
                    .|..|    |..|:      .|:.|||||||..||.|:.||.||::||.:||:||:|
Human   517 PTKKTWFDKPNFNRTNSPGFQKKVQFGNENTKLELRKVPPELNNISKLNEHFSRFGTLVNLQVAY 581

  Fly   597 EGDPEAAIVTFSTHAEANVAYRSTEAVLNNRFIKVFWHNDSSGADVGQMNQMGGGGGGGGRKNAS 661
            .||||.|::.|:|:.||..|..|||||||||||||:||.:      |...|:         :..|
Human   582 NGDPEGALIQFATYEEAKKAISSTEAVLNNRFIKVYWHRE------GSTQQL---------QTTS 631

  Fly   662 QYHLHNVPAVPTPNADGAKISNANPLTEAGAGNIGTPATEQANTAAPASM-------RL------ 713
            ...:.  |.|..|.....|.|....|....:..|.....:.|::..|.::       ||      
Human   632 PKVMQ--PLVQQPILPVVKQSVKERLGPVPSSTIEPAEAQSASSDLPQNVTKLSVKDRLGFVSKP 694

  Fly   714 ------KLNTTTAGGSAGGAAGAGAPGSGRPLNPAANAASIRKKQEEQQKAVHQLANGLRKRKQE 772
                  |:.:|:.|.:......|....:.:.|..:.:|....:.|:::|:|: :|...:||||||
Human   695 SVSATEKVLSTSTGLTKTVYNPAALKAAQKTLLVSTSAVDNNEAQKKKQEAL-KLQQDVRKRKQE 758

  Fly   773 LLQSYMKQMKTALELVER---MDQQDPQRAPTLQTIKVLQMTIDKLRKEIKADQDQLQAQMQQQQ 834
            :|:.:::..|..:..:|:   |..:|  :|..::|::||...|.||:.|:||          ...
Human   759 ILEKHIETQKMLISKLEKNKTMKSED--KAEIMKTLEVLTKNITKLKDEVKA----------ASP 811

  Fly   835 QQQQPPVKKTKEQQKKELLDMELELIAQQQEGNDTTAIQKRLEELQ---RNLGVGSAANNKSTHY 896
            .:..|...|||.|.:|||||.||:|..:.|.|.:.|.::::..|||   ...|:.|:...:..|.
Human   812 GRCLPKSIKTKTQMQKELLDTELDLYKKMQAGEEVTELRRKYTELQLEAAKRGILSSGRGRGIHS 876

  Fly   897 APASGAPGGGAGRKRPNLPEGPTRVDRRPKAIVVTGFAAEEADFVLGHFKNFGEISKHDVDREIP 961
            .......|.|.||.|.....|...||.||:|:.::.|...:.:.:|.||..:|||....:|....
Human   877 RGRGAVHGRGRGRGRGRGVPGHAVVDHRPRALEISAFTESDREDLLPHFAQYGEIEDCQIDDSSL 941

  Fly   962 QLILSYATRLNAEQAVLRGKMYKDKRLQISWAPVVTPAPAPMAAPVE 1008
            ..::::.||..||.|.:.|..:|.:.|:::|...||...|.....||
Human   942 HAVITFKTRAEAEAAAVHGARFKGQDLKLAWNKPVTNISAVETEEVE 988

Known Domains:


GeneSequenceDomainRegion External IDIdentity
swmNP_001260586.1 RRM1_RBM26_like 561..634 CDD:240703 46/73 (63%)
RRM2_RBM26_like 921..992 CDD:240704 21/71 (30%)
RBM26XP_011533481.1 PWI 11..76 CDD:295364 44/65 (68%)
DUF1777 132..>165 CDD:285811 6/54 (11%)
ZnF_C3H1 <294..314 CDD:214632 14/20 (70%)
RRM1_RBM26 546..621 CDD:240960 47/75 (63%)
Enkurin 753..834 CDD:290575 32/93 (34%)
RRM2_RBM26_like 901..972 CDD:240704 21/71 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C334648898
eggNOG 1 0.900 E1_KOG2135
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 375 1.000 Inparanoid score I2081
Isobase 1 0.950 0 Normalized mean entropy S7344
OMA 1 1.010
OrthoDB 1 1.010 D324834at33208
OrthoFinder 1 1.000 FOG0002051
OrthoInspector 1 1.000 T609818
orthoMCL 1 0.900 OOG5_129444
Panther 1 1.100 O PTHR14398
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3653
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1413.750

Return to query results.
Submit another query.