DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: swm and rbm26

Sequence 1:NP_001260586.1 Gene:swm FlyBaseID:FBgn0002044 Length:1063 Species:Drosophila melanogaster
Sequence 2:XP_002662309.4 Gene:rbm26 ZFINID:ZDB-GENE-050706-50 Length:1007 Species:Danio rerio

Alignment Length:1210 Identity:344/1211 (28%)
Similarity:511/1211 (42%) Gaps:350/1211 (29%)


  Fly     1 MILENSDKLKDWLSVVLEPLCDADSSALARYVIALLKKDKSDKDLKRIMIEQLDVFLSEETTRFV 65
            ||:||.:.||.|||..|||:||||.||||:||:||:|||||:|:||.:.|:||||||.:||..||
Zfish     1 MIIENLEALKTWLSKTLEPICDADPSALAKYVVALVKKDKSEKELKALCIDQLDVFLQKETQTFV 65

  Fly    66 ERLFDAIASEEYLTVPAAPLITASSASTAELTVDQELALVIDGPQDDIEAVLVADSPPPPPKDNV 130
            ::||:|:.::.||..|..| ..||...|.:.|...|                 |....||.:|  
Zfish    66 DKLFEAVNAKSYLPQPEQP-TPASRPETHQRTEKDE-----------------AKREEPPSRD-- 110

  Fly   131 IKPDSNQVKLEQASQDAREAEALAFISQEAGIAMHVPTDAKPAFDQHKTKDSHNQQSASNYQHHH 195
                           :.||.:....|:.....:.....|::...|:.|...|..::...|     
Zfish   111 ---------------EDREKKFSRRINHSPPSSSRYSRDSRRVDDRKKDDRSRKREYDRN----- 155

  Fly   196 VRSASPPGRSSGVSGSGGGGPGGAGLAAGYADKENQPRDSRRRRASLRSRSRSRSRSNERAFRRS 260
                 ||.|.|                  |.::.|:    ||.|:...|||||||.|.:|...|.
Zfish   156 -----PPRRDS------------------YRERYNR----RRERSRSYSRSRSRSWSKDRTRDRD 193

  Fly   261 RSRDRRVNEREKTQRQFRNKSPPGSQTDNRHHGRRNFDRRRIGGNADDRPRFGNNKSRRSHSRSM 325
            |.|||   :|::::.:.|.:|...|::..|..|:..::                      |||  
Zfish   194 RERDR---DRDRSRSRSRTRSRSRSRSRERDSGKPKYE----------------------HSR-- 231

  Fly   326 SPERNARRNQNSPDRVQTAQANLIPAP----------------VAPPAPVEH-----------PA 363
             |||        |:...|......|.|                :...||..|           |.
Zfish   232 -PER--------PEGATTDGYTAAPLPPVNSSAHFPVPTLSSTITVIAPTHHGNNTTESWSEFPQ 287

  Fly   364 SH--------PRQRCRDFDEKGYCVRGETCPWDHGVNPVVFEGINNTSLMMSMREYNPDAPEIWA 420
            .|        ||:||||:||||:|:||:.||:|||.:|||.|.:|..|::    .:.|  |.:..
Zfish   288 DHTPFGRGGPPRKRCRDYDEKGFCMRGDMCPFDHGSDPVVVEDVNLPSIL----PFQP--PPLPG 346

  Fly   421 RSGGPPPGAG------------QGPVPPP-TQPGQTTINPFSG---------------------N 451
            ..|.||||..            :.||||| |.|  .::.|.:|                     :
Zfish   347 VDGPPPPGLPPPHALLTPPVNLRPPVPPPGTMP--PSLPPVAGPPPPLPALQPSGMDGPPNSITS 409

  Fly   452 VRPTTLMSGSGPSPMGVPNPADYARNPGAP----PQAAMMPFPFNPTAVTTPLQR--------QL 504
            ..||.:.||..| ||..|.|..:..:|..|    |:|        |:..:.|:.|        .|
Zfish   410 SVPTIVTSGIRP-PMTQPPPPLFTSDPFEPDVYNPEA--------PSMTSRPMYRHRVNAQRPNL 465

  Fly   505 IPIPV--VDGAPTGGVAEVGKRRFELEDT-----VAIADVPTKRKVPINSRLGPRVN-PNMQQH- 560
            |.:.:  :|..|...::.....|..||..     ..:.|:....|.|...:  |..| ||  .| 
Zfish   466 IGLTMAEMDLPPREKMSNSNNARIVLESDSRKRGAGLHDLAIPPKKPWFDK--PNFNKPN--HHG 526

  Fly   561 ----------NSSLELRKVPRGLNTIAHLNNHFAKFGKIVNIQVSYEGDPEAAIVTFSTHAEANV 615
                      |:.|.:.::|..||.|:.||.||:|||.|||:||:|..|||.|::.|:|..||..
Zfish   527 FHRKVPFPLANTKLAIGQIPPELNNISKLNQHFSKFGTIVNLQVAYNNDPEGALIQFATPEEARR 591

  Fly   616 AYRSTEAVLNNRFIKVFWHNDSSGADVGQMNQMGGGGGGGGRKNASQYHLH----------NVPA 670
            |.:|||||||||||:|.||.:.                       :..|:|          ..||
Zfish   592 AIQSTEAVLNNRFIRVNWHRED-----------------------TVEHMHPKPHPSVQPAQEPA 633

  Fly   671 V--------------PTPNADGAKISNANPLTEAGAGNIGTPATEQANTAAPASMRLKLNTTTAG 721
            |              |||:.:.....:..|     ...:.....|:...:.|..:..|:.:|:.|
Zfish   634 VTALKQSVKDRLGPLPTPHPEPTPAPSGPP-----QNTLKASVKERLGFSKPPGLGTKVLSTSTG 693

  Fly   722 --GSAGGAAGAGAPGSGRPLNPAANAASIRKKQEEQQKAVHQLANGLRKRKQELLQSYMKQMKTA 784
              .:....|...|...|.|.:.:.:|....|:::|..|    |...:||:|||:|:.:::..|..
Zfish   694 LTKTVYNPAALKAGQKGAPFSASVSAEDALKRKQEAMK----LQQDVRKKKQEILEKHIQTQKLL 754

  Fly   785 LELVER---MDQQDPQRAPTLQTIKVLQMTIDKLRKEIK--ADQDQLQAQMQQQQQQQQPPVKKT 844
            :..:|:   |..:|  :|..:||:..|..:|.||::|||  :..:.|:..:            |:
Zfish   755 ISRLEKNKSMKAED--KAQIMQTLTSLTNSITKLQEEIKGLSSANALRTTV------------KS 805

  Fly   845 KEQQKKELLDMELELIAQQQEGNDTTAI-----QKRLEELQRNL-----GVGSAANNKSTHYAPA 899
            |.|.:|||||.||:|..:.|.|.||..:     |.:||..:|.|     |.|:.:..:....:..
Zfish   806 KAQAQKELLDTELDLYKKMQAGEDTAELKIKYTQLQLEAAKRGLLTPGRGRGAHSRGRGALRSRG 870

  Fly   900 SGAPGGGAGRKRPNLPEGPTR--VDRRPKAIVVTGFAAEEADFV--LGHFKNFGEISKHDVDREI 960
            .|..|.|.|        .||.  ||.||:|:.::||:  |||.|  |.||..:|||....::...
Zfish   871 RGIRGRGRG--------APTHAVVDHRPRALEISGFS--EADRVDLLPHFAQYGEIEDCQMEDSS 925

  Fly   961 PQLILSYATRLNAEQAVLRGKMYKDKRLQISW-APVVT-PAPAPMAAPVEKSAAPGDMSVSLENP 1023
            ...|::|.||..||||.:.|....::.|:::| .|..: ....|..|..|....|.|..|     
Zfish   926 LSAIITYKTRAEAEQAAIHGVRLNNQELRLAWHKPTASLNTTDPDEAEAEDEEFPEDSLV----- 985

  Fly  1024 KQLIQSVSESESLLGSDTLPELRLEDEEEDEESEDRSWRR 1063
                     .:|||         .:|:||:|::|.|||||
Zfish   986 ---------DDSLL---------QDDDEEEEDNESRSWRR 1007

Known Domains:


GeneSequenceDomainRegion External IDIdentity
swmNP_001260586.1 RRM1_RBM26_like 561..634 CDD:240703 41/73 (56%)
RRM2_RBM26_like 921..992 CDD:240704 27/73 (37%)
rbm26XP_002662309.4 PWI 7..72 CDD:295364 42/65 (65%)
ZnF_C3H1 <302..322 CDD:214632 14/20 (70%)
RRM 453..740 CDD:223796 83/323 (26%)
RRM_SF 537..612 CDD:302621 42/75 (56%)
DUF3508 <731..>853 CDD:288841 43/140 (31%)
RRM2_RBM26_like 886..957 CDD:240704 27/73 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C334650993
eggNOG 1 0.900 E1_KOG2135
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D324834at33208
OrthoFinder 1 1.000 FOG0002051
OrthoInspector 1 1.000 T597499
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR14398
Phylome 1 0.910 0.800 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
109.820

Return to query results.
Submit another query.