DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: swm and RBM27

Sequence 1:NP_001260586.1 Gene:swm FlyBaseID:FBgn0002044 Length:1063 Species:Drosophila melanogaster
Sequence 2:XP_005268523.1 Gene:RBM27 HGNCID:29243 Length:1061 Species:Homo sapiens

Alignment Length:1303 Identity:323/1304 (25%)
Similarity:488/1304 (37%) Gaps:482/1304 (37%)


  Fly     1 MILENSDKLKDWLSVVLEPLCDADSSALARYVIALLKKDKSDKDLKRIMIEQLDVFLSEETTRFV 65
            |::|:.|.||.||:.:|||:||||.||||.||:||:||||.:|:||....:||||||.:||:.||
Human     1 MLIEDVDALKSWLAKLLEPICDADPSALANYVVALVKKDKPEKELKAFCADQLDVFLQKETSGFV 65

  Fly    66 ERLFDAIASEEYLTVPAAPLITASSASTAELTVDQELALVIDGPQDDIEAVLVADSPPPPPKDNV 130
            ::||:::.::.||     ||:                                   .|..|:...
Human    66 DKLFESLYTKNYL-----PLL-----------------------------------EPVKPEPKP 90

  Fly   131 IKPDSNQVK---LEQASQDAREAEALAFISQEAGIAMHVPTDAKPAFDQHKTKDSHNQQSA-SNY 191
            :..:..::|   .::.:::.|:.....:.|         |...:....:.:|::...:... .:|
Human    91 LVQEKEEIKEEVFQEPAEEERDGRKKKYPS---------PQKTRSESSERRTREKKREDGKWRDY 146

  Fly   192 QHHHVRSASPPGRSSGVSGSGGGGPGGAGLAAGYADKENQPRDSRRRRASLRSRSRSRSRSNERA 256
            ..::.|:..                        |.:|    .|.||.|:..||:||..|||..|:
Human   147 DRYYERNEL------------------------YREK----YDWRRGRSKSRSKSRGLSRSRSRS 183

  Fly   257 FRRSRSRDRRVNEREKTQRQFRNKSPPGSQTDNRHHGRRNFDRRRIGGNADDRPRFGNNKSRRSH 321
            ..||:.||...|..|                   |..|..|...|             |....|:
Human   184 RGRSKDRDPNRNVVE-------------------HRERSKFKSER-------------NDLESSY 216

  Fly   322 SRSMSPERNARRNQNSPDRVQTAQANLIPAPVAPPAPVEHPA-----------SH---------- 365
            ....:|..|:....:|       .|..||:.|...||..|..           :|          
Human   217 VPVSAPPPNSSEQYSS-------GAQSIPSTVTVIAPAHHSENTTESWSNYYNNHSSSNSFGRNL 274

  Fly   366 -PRQRCRDFDEKGYCVRGETCPWDHGVNPVVFEGINNTSLMMSMREYNPDAPEIWARSGGPPPGA 429
             |::||||:||:|:||.|:.|.:|||.:|:|.:.:    .:.||..:.|           |||| 
Human   275 PPKRRCRDYDERGFCVLGDLCQFDHGNDPLVVDEV----ALPSMIPFPP-----------PPPG- 323

  Fly   430 GQGPVPPPTQPGQTTINPFSG---NVRPTTLMSGSGPSPMGVPNPADYARNP-----GAPPQAAM 486
                :|||..||. .:.|..|   ...|     |.||.|...|.|....|.|     |.||.:.:
Human   324 ----LPPPPPPGM-LMPPMPGPGPGPGP-----GPGPGPGPGPGPGHSMRLPVPQGHGQPPPSVV 378

  Fly   487 MPFPFNP-------------------------TAVTTPLQRQLI--------------------- 505
            :|.|..|                         |.:..||.:.|:                     
Human   379 LPIPRPPITQSSLINSRDQPGTSAVPNLASVGTRLPPPLPQNLLYTVSERQPMYSREHGAAASER 443

  Fly   506 ---------------------------------PIPVV------DG----APTGGVAEVGKRRF- 526
                                             |.|:|      ||    ||:  :...|:.:: 
Human   444 LQLGTPPPLLAARLVPPRNLMGSSIGYHTSVSSPTPLVPDTYEPDGYNPEAPS--ITSSGRSQYR 506

  Fly   527 ---------------------ELEDTVAIADVPTKRKVP--INSR-------------------- 548
                                 ::....|...:.|:..||  |||.                    
Human   507 QFFSRTQTQRPNLIGLTSGDMDVNPRAANIVIQTEPPVPVSINSNITRVVLEPDSRKRAMSGLEG 571

  Fly   549 -------LGPRVNPNM---------QQHNSSLELRKVPRGLNTIAHLNNHFAKFGKIVNIQVSYE 597
                   ||.:.|.|.         |..|:.||::|:|:.||.|..||.||:|||.||||||:::
Human   572 PLTKKPWLGKQGNNNQNKPGFLRKNQYTNTKLEVKKIPQELNNITKLNEHFSKFGTIVNIQVAFK 636

  Fly   598 GDPEAAIVTFSTHAEANVAYRSTEAVLNNRFIKVFWHND--------SSGADVGQMNQMGGGGGG 654
            ||||||::.:.|:.||..|..|||||||||||:|.||.:        ||...:.|..|.      
Human   637 GDPEAALIQYLTNEEARKAISSTEAVLNNRFIRVLWHRENNEQPTLQSSAQLLLQQQQT------ 695

  Fly   655 GGRKNASQYHLHNVP------------AVPT------------PNADGAKISNANPLTE--AGAG 693
              ..:.||.| |::|            :.|:            |...||.:.|..|:..  ..||
Human   696 --LSHLSQQH-HHLPQHLHQQQVLVAQSAPSTVHGGIQKMMSKPQTSGAYVLNKVPVKHRLGHAG 757

  Fly   694 NIGTPATEQANTAAPASMRLKLNTTTAGGSAGGAAGAGAPGSGRPLNPAANAAS----------- 747
            ...:.|:...|              .:||:.........||..:.:..::|..:           
Human   758 GNQSDASHLLN--------------QSGGAGEDCQIFSTPGHPKMIYSSSNLKTPSKLCSGSKSH 808

  Fly   748 -----IRKKQEEQQKAVHQLANGLRKRKQELLQSYMKQMKTALELVERMDQQDP-QRAPTLQTIK 806
                 ::||||..     :|...:||::||:|:..::..|..:..:|:.....| :||..::|:|
Human   809 DVQEVLKKKQEAM-----KLQQDMRKKRQEVLEKQIECQKMLISKLEKNKNMKPEERANIMKTLK 868

  Fly   807 VLQMTIDKLRKEIKADQDQLQAQMQQQQQQQQPPVKKTKEQQKKELLDMELELIAQQQEGNDTTA 871
            .|...|.:|:.|:|.           ......|...|||.:.:|||||.||:|..:...|.|||.
Human   869 ELGEKISQLKDELKT-----------SSAVSTPSKVKTKTEAQKELLDTELDLHKRLSSGEDTTE 922

  Fly   872 IQKRLEELQ---RNLGVGSAANNKSTHYAPASGAPGGGAGRKRPNLPEGPTR---VDRRPKAIVV 930
            ::|:|.:||   ..||:......|:      ..:.|.|.||.|.....|...   ||.||||:.|
Human   923 LRKKLSQLQVEAARLGILPVGRGKT------MSSQGRGRGRGRGGRGRGSLNHMVVDHRPKALTV 981

  Fly   931 TGFAAEEADFVLGHFKNFGEISKHDVDREIPQLILSYATRLNAEQAVLRGKMYKDKRLQISWAPV 995
            .||..||.:.:|.||....:                             |..:||:||||||   
Human   982 GGFIEEEKEDLLQHFSTANQ-----------------------------GPKFKDRRLQISW--- 1014

  Fly   996 VTPAPAPMAAPVEKSAAPGDMSVSLENPKQLIQSVSESESLLGSDTLPELRLEDEEEDEESEDRS 1060
                        .|...|   |:|.|..:   :.|.|.|:......||:   :|:|:::|.|.||
Human  1015 ------------HKPKVP---SISTETEE---EEVKEEETETSDLFLPD---DDDEDEDEYESRS 1058

  Fly  1061 WRR 1063
            |||
Human  1059 WRR 1061

Known Domains:


GeneSequenceDomainRegion External IDIdentity
swmNP_001260586.1 RRM1_RBM26_like 561..634 CDD:240703 44/73 (60%)
RRM2_RBM26_like 921..992 CDD:240704 22/71 (31%)
RBM27XP_005268523.1 PWI 7..72 CDD:295364 39/65 (60%)
zf-CCCH 278..300 CDD:279036 13/22 (59%)
RRM_RBM27 600..675 CDD:240961 45/75 (60%)
DUF342 <814..903 CDD:302792 28/105 (27%)
RRM_SF 972..1014 CDD:302621 22/71 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C334654051
eggNOG 1 0.900 E1_KOG2135
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 375 1.000 Inparanoid score I2081
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D324834at33208
OrthoFinder 1 1.000 FOG0002051
OrthoInspector 1 1.000 T609818
orthoMCL 1 0.900 OOG5_129444
Panther 1 1.100 O PTHR14398
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3653
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1312.800

Return to query results.
Submit another query.