DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: swm and rbm26

Sequence 1:NP_001260586.1 Gene:swm FlyBaseID:FBgn0002044 Length:1063 Species:Drosophila melanogaster
Sequence 2:NP_998868.1 Gene:rbm26 XenbaseID:XB-GENE-960053 Length:626 Species:Xenopus tropicalis

Alignment Length:788 Identity:196/789 (25%)
Similarity:300/789 (38%) Gaps:280/789 (35%)


  Fly     1 MILENSDKLKDWLSVVLEPLCDADSSALARYVIALLKKDKSDKDLKRIMIEQLDVFLSEETTRFV 65
            ||:|:.:.||.|||..|||:||||.||||:||:||:||||:|::||.:.|:||||||.:||..||
 Frog     1 MIIEDFEALKHWLSKTLEPICDADPSALAKYVLALVKKDKTDRELKALCIDQLDVFLQKETQGFV 65

  Fly    66 ERLFDAIASEEYLTVPAAPLITASSASTAELTVDQELALVIDGPQDDIEAVLVADSPPPPPKDNV 130
            ::|||||.::.||..|       .|.|||.:.:|     ..:..:.:|:            ||.|
 Frog    66 DKLFDAINTKNYLPQP-------DSTSTAVVKLD-----TFEHQEREIK------------KDEV 106

  Fly   131 IKPDSNQVK----LEQASQDAREAEALAFISQEAGIAMHVPTDAKPAFDQHK-----TKDSHNQQ 186
            .|.:..:.|    |.|:.|                          |:..:||     .|.|::.:
 Frog   107 NKEEEKEKKAPRRLNQSPQ--------------------------PSITRHKETRENRKRSNSDR 145

  Fly   187 SASNYQHHHVRSASP---------PGRSSGVSGSGGGGPGGAGLAAGYADKENQPRDSRRRRASL 242
            .:|:.| :..||..|         |.|.|......         |.....::::.|:.|.|:...
 Frog   146 ESSSIQ-NSFRSGLPEQKLDVDAAPTRLSSNKVQN---------AKNIRSRDDRKREDRFRKREY 200

  Fly   243 -----------------RSRSRSRSRSNERAFRRSRSRDRRVNEREKTQRQFRNKSPPGSQTDNR 290
                             |.||||.|||..|::.:.|.|||   ||::::.:.|::        ::
 Frog   201 DRNVPRRDLYRDRYNRRRGRSRSYSRSRSRSWSKERQRDR---ERDRSRSRTRSR--------DK 254

  Fly   291 HHGRRNFDRRRIGGNADDRPRFGNNKSRRSHSRSMSPERNARRNQNSPDRVQTAQANLIPAP--- 352
            ..|:..||..|                       ..|..|:..:.:|...:..|.   .|.|   
 Frog   255 DSGKPKFDLDR-----------------------SDPVDNSYASGSSVSHIGPAH---FPVPTLS 293

  Fly   353 --VAPPAPVEH--------PASH--------------PRQRCRDFDEKGYCVRGETCPWDHGVNP 393
              :....|..|        |..|              |::||||:||||:|:||:.||:|||.:|
 Frog   294 STITVITPSHHGNSSAENWPEFHEDQVDHSNYGRPQIPKKRCRDYDEKGFCMRGDMCPFDHGSDP 358

  Fly   394 VVFEGINNTSLMMSMREYNPDAPEIWARSGGPPPGAGQGPVPPPTQPGQTTINPFSGNVRPTTLM 458
            ||.|.:|...::....:  |.|.|     |.||||.   |.|||      .:.|...|:||    
 Frog   359 VVVEDVNLPGILPFPAQ--PPAVE-----GPPPPGL---PPPPP------LLTPPPVNLRP---- 403

  Fly   459 SGSGPSPMGVPNPADYARNPGAPP------QAAMMPFPFNPTAVTTPLQRQLIPI---------- 507
                  |:..|.|..    |..||      |..:.......|......|..|.|:          
 Frog   404 ------PVPPPGPLP----PSLPPITENEVQVRLRTIREQVTESQMWDQNSLFPVKRRKQVYVNR 458

  Fly   508 ----PVVDGAPTGGVAEVG--KRRFELEDTVAIADVPTKRKVPINSRLGPRVNPNMQQHNSSLEL 566
                .:::...|..:.:.|  :|.::|         |...|:.:|..         ...:|.|:.
 Frog   459 CFLKKIMEPGKTSDIEKNGMLERCYQL---------PRTEKLQVNKG---------TSDSSQLQF 505

  Fly   567 RKVPRGLNTIAHLNNHFAKFGKIVNIQVSYEGDPEAAI----------VTFSTHAEANVAYRSTE 621
            ..    ||.:....:.|      |..|.|.|.|.|...          |......|.::      
 Frog   506 NM----LNKMQGYQDAF------VQPQYSKELDEETGFCKTLIPYMRRVPLDRRLEMHI------ 554

  Fly   622 AVLNNRFIKVFWHNDSSGADVGQMNQMGGGGGGGGRKNASQYHLHNVPA-VPTP---NADGAKIS 682
            ||||  .|..|..:.:|                .|:..:..:   .:|: :|||   ||..:.||
 Frog   555 AVLN--CISSFCQSPAS----------------SGQNPSVPF---TIPSLLPTPLSVNASRSCIS 598

  Fly   683 NANPLTEA 690
            :..|.:::
 Frog   599 DIPPYSQS 606

Known Domains:


GeneSequenceDomainRegion External IDIdentity
swmNP_001260586.1 RRM1_RBM26_like 561..634 CDD:240703 19/83 (23%)
RRM2_RBM26_like 921..992 CDD:240704
rbm26NP_998868.1 PWI 7..72 CDD:321990 42/65 (65%)
ZnF_C3H1 <335..355 CDD:214632 14/20 (70%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C334639746
eggNOG 1 0.900 E1_KOG2135
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D741871at2759
OrthoFinder 1 1.000 FOG0002051
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
76.720

Return to query results.
Submit another query.