DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: swm and Rbm27

Sequence 1:NP_001260586.1 Gene:swm FlyBaseID:FBgn0002044 Length:1063 Species:Drosophila melanogaster
Sequence 2:XP_006222619.1 Gene:Rbm27 RGDID:1311966 Length:1066 Species:Rattus norvegicus

Alignment Length:1303 Identity:328/1304 (25%)
Similarity:508/1304 (39%) Gaps:477/1304 (37%)


  Fly     1 MILENSDKLKDWLSVVLEPLCDADSSALARYVIALLKKDKSDKDLKRIMIEQLDVFLSEETTRFV 65
            |::|:.|.||.||:.:|||:||||.||||.||:||:||||.:|:||....:||||||.:||:.||
  Rat     1 MLIEDVDALKSWLAKLLEPICDADPSALANYVVALVKKDKPEKELKAFCADQLDVFLQKETSGFV 65

  Fly    66 ERLFDAIASEEYLTVPAAPLITASSASTAELTVDQELALVIDGPQDDIEAVLVADSPPPPPKDNV 130
            ::||:::.::.||. |..|:                                   .|.|.|    
  Rat    66 DKLFESLYTKNYLP-PLEPV-----------------------------------KPEPKP---- 90

  Fly   131 IKPDSNQVK---LEQASQDAREAEALAFISQEAGIAMHVPTDAKPAFDQHKTKDSHNQQSA-SNY 191
            :..:..::|   .::.:::.|:.....:.|         |..::....:.:|::...:... .:|
  Rat    91 LVQEKEEIKEEVFQEPAEEERDVRKKKYPS---------PQKSRSESSERRTREKKREDGKWRDY 146

  Fly   192 QHHHVRSASPPGRSSGVSGSGGGGPGGAGLAAGYADKENQPRDSRRRRASLRSRSRSRSRSNERA 256
            :.::.|:..                        |.:|    .|.||.|:..||:||..|||..|:
  Rat   147 ERYYERNEL------------------------YREK----YDWRRGRSKSRSKSRGLSRSRSRS 183

  Fly   257 FRRSRSRD--RRVNEREKTQ-RQFRN---------KSPPGSQTDNRHHGRRNF--------DRRR 301
            ..||:.||  |.|..||::: :..||         .:||.:.::....|.::.        ....
  Rat   184 RGRSKDRDPNRNVEHRERSKFKSERNDLESSYVPVSAPPPNSSEQYSSGAQSIPSTVTVIAPAHH 248

  Fly   302 IGGNADDRPRFGNNKSRRSHSRSMSPERNARRNQNSPDRVQTAQANLIPAPVAPPAPVEHPASHP 366
            .....:....:.||     ||.|.|..||                        ||         |
  Rat   249 SENTTESWSNYYNN-----HSSSNSFGRN------------------------PP---------P 275

  Fly   367 RQRCRDFDEKGYCVRGETCPWDHGVNPVVFEGINNTSLMMSMREYNPDAPEIWARSGGPPPGAGQ 431
            ::||||:||:|:||.|:.|.:|||.:|:|.:.:    .:.||..:.|           ||||   
  Rat   276 KRRCRDYDERGFCVLGDLCQFDHGNDPLVVDEV----ALPSMIPFPP-----------PPPG--- 322

  Fly   432 GPVPPPTQPGQTTINPFSG---NVRPTTLMSGSGPSPMGVPNPADYARNP-----GAPPQAAMMP 488
              :|||..||. .:.|..|   ...|     |.||.|...|.|....|.|     |.||.:.::|
  Rat   323 --LPPPPPPGM-LMPPMPGPGPGPGP-----GPGPGPGPGPGPGHSMRLPVPQGHGQPPPSVVLP 379

  Fly   489 FPFNPTAVTT-------------------------PLQRQLI----------------------- 505
            .|..|.:.::                         ||.:.|:                       
  Rat   380 IPRPPISQSSLINSRDQPGTSAVPNLAPVGARLPPPLPQNLLYTVSERQPMYSREHGAAASERLQ 444

  Fly   506 -------------------------------PIPVV------DG----APTGGVAEVGKRRF--- 526
                                           |.|:|      ||    ||:  :...|:.::   
  Rat   445 LGTPPPLLAARLVPPRNLMGSSIGYHTSVSSPTPLVPDTYEPDGYNPEAPS--ITSSGRSQYRQF 507

  Fly   527 -------------------ELEDTVAIADVPTKRKVP--INSR---------------------- 548
                               :.....|...:.|:..||  |||.                      
  Rat   508 FSRAQTQRPNLIGLTSGDMDANPRAANIVIQTEPPVPVSINSNITRVVLEPESRKRAISGLEGPL 572

  Fly   549 -----LGPRVNPNM---------QQHNSSLELRKVPRGLNTIAHLNNHFAKFGKIVNIQVSYEGD 599
                 ||.:.|.|.         |..|:.||::|:|:.||.|..||.||:|||.||||||:::||
  Rat   573 TKKPWLGKQGNNNQSKPGFLRKNQYTNTKLEVKKIPQELNNITKLNEHFSKFGTIVNIQVAFKGD 637

  Fly   600 PEAAIVTFSTHAEANVAYRSTEAVLNNRFIKVFWHNDS-------SGADV--GQMNQMGGGGGGG 655
            ||||::.:.|:.||..|..|||||||||||:|.||.::       |.|.:  .|.:.:       
  Rat   638 PEAALIQYLTNEEARKAISSTEAVLNNRFIRVLWHRENNEQPALQSSAQILLQQQHTL------- 695

  Fly   656 GRKNASQYHLHNVP------------AVPT------------PNADGAKISNANPLTEAGAGNIG 696
              .:.||.| ||:|            :.|:            |...||.:.|..|:..    .:|
  Rat   696 --SHLSQQH-HNLPQHLHPQQVMVTQSSPSSVHGGIQKMMGKPQTSGAYVLNKVPVKH----RLG 753

  Fly   697 TPATEQANTAAPASMRLKLNTTTAGGSAGGAAGA-GAPGSGRPLNPAANAAS------------- 747
            ...|.|::|:.      .||.|  |||:|..... ..||..:.:..::|..:             
  Rat   754 HATTNQSDTSH------LLNQT--GGSSGDDCPVFSTPGHPKTIYSSSNLKAPSKLCSGSKSHDV 810

  Fly   748 ---IRKKQEEQQKAVHQLANGLRKRKQELLQSYMKQMKTALELVERMDQQDP-QRAPTLQTIKVL 808
               ::||||..     :|...:||::||:|:..::..|..:..:|:.....| :||..::|:|.|
  Rat   811 QEVLKKKQEAM-----KLQQDMRKKRQEMLEKQIECQKMLISKLEKNKNMKPEERANIMKTLKEL 870

  Fly   809 QMTIDKLRKEIKADQDQLQAQMQQQQQQQQPPVKKTKEQQKKELLDMELELIAQQQEGNDTTAIQ 873
            ...|.:|:.|:|.           ......|...|||.:.:|||||.||:|..:...|.|||.::
  Rat   871 GEKISQLKDELKT-----------SSAVSTPSKVKTKTEAQKELLDTELDLHKRLSSGEDTTELR 924

  Fly   874 KRLEELQ---RNLGVGSAANNKSTHYAPASGAPGGGAGRKRPNLPEGPTRVDRRPKAIVVTGFAA 935
            |:|.:||   ..||:......|:.    :|...|.|.||.|.........||.||||:...||..
  Rat   925 KKLSQLQVEAARLGILPVGRGKTM----SSQGRGRGRGRGRGRGSLNHMVVDHRPKALPAGGFIE 985

  Fly   936 EEADFVLGHFKNFGEISKHDVDREIPQLILSYATRLNAEQAVLRGKMYKDKRLQISWAPVVTPAP 1000
            ||.:.:|.||....:.||                             :||:||||||        
  Rat   986 EEKEELLQHFSATNQSSK-----------------------------FKDRRLQISW-------- 1013

  Fly  1001 APMAAPVEKSAAPGDMSVSLENPKQLIQ-----SVSESESLLGSDTLPELRLEDEEEDEESEDRS 1060
                   .|...|   |:|.|..::.::     ::.|:|:   ||..  |..:|:|:::|.|.||
  Rat  1014 -------HKPKVP---SISTETEEEEVKEEVKSAIRETET---SDLF--LHDDDDEDEDEYESRS 1063

  Fly  1061 WRR 1063
            |||
  Rat  1064 WRR 1066

Known Domains:


GeneSequenceDomainRegion External IDIdentity
swmNP_001260586.1 RRM1_RBM26_like 561..634 CDD:240703 44/73 (60%)
RRM2_RBM26_like 921..992 CDD:240704 22/71 (31%)
Rbm27XP_006222619.1 PWI 7..72 CDD:295364 39/65 (60%)
zf-CCCH 277..299 CDD:279036 13/22 (59%)
RRM_RBM27 599..674 CDD:240961 45/75 (60%)
RRM_SF 971..1013 CDD:302621 22/71 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C334641418
eggNOG 1 0.900 E1_KOG2135
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 374 1.000 Inparanoid score I2008
OMA 1 1.010
OrthoDB 1 1.010 D324834at33208
OrthoFinder 1 1.000 FOG0002051
OrthoInspector 1 1.000 T618748
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR14398
Phylome 00.000 Not matched by this tool.
TreeFam 1 0.960
109.960

Return to query results.
Submit another query.