DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: swm and Rbm26

Sequence 1:NP_001260586.1 Gene:swm FlyBaseID:FBgn0002044 Length:1063 Species:Drosophila melanogaster
Sequence 2:XP_006252484.1 Gene:Rbm26 RGDID:1308297 Length:1017 Species:Rattus norvegicus

Alignment Length:1183 Identity:346/1184 (29%)
Similarity:508/1184 (43%) Gaps:290/1184 (24%)


  Fly     1 MILENSDKLKDWLSVVLEPLCDADSSALARYVIALLKKDKSDKDLKRIMIEQLDVFLSEETTRFV 65
            ||:||.:.||.|||..|||:||||.||||:||:||:|||||:|:||.:.|:||||||.:||..||
  Rat     5 MIIENFEALKSWLSKTLEPICDADPSALAKYVLALVKKDKSEKELKALCIDQLDVFLQKETQIFV 69

  Fly    66 ERLFDAIASEEYLTVPAAPLITASSASTAELTVDQELALVIDGPQDDIEAVLVADSPPPPPKDNV 130
            |:||||:.::.||..|..|       |:..|.||     .:...:.||:            |:.:
  Rat    70 EKLFDAVNTKSYLPPPEQP-------SSGSLKVD-----FLQHQEKDIK------------KEEL 110

  Fly   131 IKPDSNQVKLEQASQDAREAEALAFISQEAGIAMHVPTDAKPAFDQHKTKDSHNQQSASNYQHHH 195
            .|.:..:.|..:...                   |.|..:...:..::::|...:...|..:.: 
  Rat   111 TKEEEREKKFSRRLN-------------------HSPPQSSSRYRDNRSRDERKKDDRSRKRDY- 155

  Fly   196 VRSASPPGRSSGVSGSGGGGPGGAGLAAGYADKENQPRDSRRRRASLRSRSRSRSRSNERAFRRS 260
              ..:||.|.|                  |.|:.|      |||...||.|||||||..:...|.
  Rat   156 --DRNPPRRDS------------------YRDRYN------RRRGRSRSYSRSRSRSWSKERLRD 194

  Fly   261 RSRDR-RVNEREKTQRQFRNKSPPGSQTDNRHHGRRNFDRRRIGGNADD---------------- 308
            |.||| |...|.:|:.:.|:...|....|.......|:.......|...                
  Rat   195 RDRDRSRTRSRSRTRSRERDLVKPKYDLDRTDPLENNYTPVSSVSNISSGHYPVPTLSSTITVIA 259

  Fly   309 RPRFGNNKSRRSHSRSMSPERNARRNQNSPDRVQTAQANLIPAPVAPPAPVEHPASHPRQRCRDF 373
            ....|||.     :.|.|.....:.:.||              .|.||.        |::||||:
  Rat   260 PTHHGNNT-----TESWSEFHEDQVDHNS--------------YVRPPM--------PKKRCRDY 297

  Fly   374 DEKGYCVRGETCPWDHGVNPVVFEGINNTSLMMSMREYNPDAPEIWARSGGPPPGAGQGPVPPPT 438
            ||||:|:||:.||:|||.:|||.|.:|    :..|..:....|.:   .|.||||.   |.||| 
  Rat   298 DEKGFCMRGDMCPFDHGSDPVVVEDVN----LPGMLPFPAQPPVV---EGPPPPGL---PPPPP- 351

  Fly   439 QPGQTTINPFSGNVRPTTLMSGSGPSPMGVPNPAD---YA-----RNPGAPP-QAAMMPFPFN-- 492
                 .:.|...|:||.  :...||.|..:|...|   |:     ..|..|| |.:.|..|.|  
  Rat   352 -----ILTPPPVNLRPP--VPPPGPLPPSLPPVTDDISYSLVLTGPPPPLPPLQPSGMDAPPNSA 409

  Fly   493 ----PTAVTTPLQRQLIPIPV---------VDG----AP--TGGVAEVGKRRFELED------TV 532
                ||.|||.:..|..|.|.         .||    ||  |.....:.:.|...:.      |.
  Rat   410 TSSVPTVVTTGIHHQPPPAPPSLFTADTYDTDGYNPEAPSITNTSRPMYRHRVHAQRPNLIGLTS 474

  Fly   533 AIADVPTKRKVPINSRL----------------------------GPRVN----PNMQQ------ 559
            ...|:|.:.|.|..|.:                            .|..|    |..|:      
  Rat   475 GDMDLPPREKPPNKSSMRIVVDSESRKRTIGSGEPGVPTKKTWFDKPNFNRTNSPGFQKKVQFGN 539

  Fly   560 HNSSLELRKVPRGLNTIAHLNNHFAKFGKIVNIQVSYEGDPEAAIVTFSTHAEANVAYRSTEAVL 624
            .|:.|||||||..||.|:.||.||::||.:||:||:|.||||.|::.|:|:.||..|..||||||
  Rat   540 ENTKLELRKVPPELNNISKLNEHFSRFGTLVNLQVAYNGDPEGALIQFATYDEAKKAISSTEAVL 604

  Fly   625 NNRFIKVFWHNDSSGADVGQMNQMGGGGGGGGRKNASQYHLHNVPAVPTPNADGAKISNANPLTE 689
            |||||||:||.:      |..:|:         :..|...:.  |.|..|.....|.|....|..
  Rat   605 NNRFIKVYWHRE------GATHQL---------QTTSPKVIQ--PLVQQPILPVVKQSVKERLGP 652

  Fly   690 AGAGNIGTPATEQANTAAPASM-------RL------------KLNTTTAGGSAGGAAGAGAPGS 735
            ..:|.:.....:.|.:..|.::       ||            |:.:|:.|.:......|....:
  Rat   653 VPSGTVEPAEAQSATSELPQNVTKLSVKDRLGFVSKPSVSATEKVLSTSTGLTKTVYNPAALKAA 717

  Fly   736 GRPL---NPAANAASIRKKQEEQQKAVHQLANGLRKRKQELLQSYMKQMKTALELVER---MDQQ 794
            .:.|   .||.:....:||::|..|    |...:||||||:|:.:::..|..:..:|:   |..:
  Rat   718 QKTLLVSTPAVDNNEAQKKKQEALK----LQQDVRKRKQEILEKHIETQKMLISKLEKNKTMKSE 778

  Fly   795 DPQRAPTLQTIKVLQMTIDKLRKEIKADQDQLQAQMQQQQQQQQPPVKKTKEQQKKELLDMELEL 859
            |  :|..::|:::|...|.||:.|:|:          ....:..|...|||.|.:|||||.||:|
  Rat   779 D--KAEIMKTLEILTKNITKLKDEVKS----------TSPGRCLPKSIKTKTQMQKELLDTELDL 831

  Fly   860 IAQQQEGNDTTAIQKRLEELQ---RNLGVGSAANNKSTHYAPASGAPGGGAGRKRPNLPEGPTRV 921
            ..:.|.|.:.|.::::..|||   ...|:.|:...:..|......|.|.|.||.|.....|...|
  Rat   832 YKKMQAGEEVTELRRKYTELQLEAAKRGILSSGRGRGIHTRGRGAAHGRGRGRGRGRGVPGHAVV 896

  Fly   922 DRRPKAIVVTGFAAEEADFVLGHFKNFGEISKHDVDREIPQLILSYATRLNAEQAVLRGKMYKDK 986
            |.||:|:.::.|...:.:.:|.||..:|||....:|......|:::.||..||.|.:.|..:|.:
  Rat   897 DHRPRALEISAFTESDREDLLPHFAQYGEIEDCQIDDSSLHAIITFKTRAEAEAAAVHGARFKGQ 961

  Fly   987 RLQISW-APVVTPAPAPMAAPVEKSAAPGDMSVSLENPKQLIQSVSESESLLGSDTLPELRLEDE 1050
            .|:::| .||     |.|:|...:.|.|.:...             :.|||:....|.    :|:
  Rat   962 DLKLAWNKPV-----ANMSAVETEEAEPDEEEF-------------QEESLVDDSLLQ----DDD 1004

  Fly  1051 EEDEESEDRSWRR 1063
            ||:|::|.|||||
  Rat  1005 EEEEDNESRSWRR 1017

Known Domains:


GeneSequenceDomainRegion External IDIdentity
swmNP_001260586.1 RRM1_RBM26_like 561..634 CDD:240703 46/73 (63%)
RRM2_RBM26_like 921..992 CDD:240704 22/71 (31%)
Rbm26XP_006252484.1 PWI 11..76 CDD:295364 44/65 (68%)
DUF1777 132..>165 CDD:285811 6/54 (11%)
ZnF_C3H1 <294..314 CDD:214632 14/20 (70%)
RRM1_RBM26 541..616 CDD:240960 47/75 (63%)
Enkurin 748..829 CDD:290575 30/93 (32%)
RRM2_RBM26_like 896..967 CDD:240704 22/71 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C334652653
eggNOG 1 0.900 E1_KOG2135
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 374 1.000 Inparanoid score I2008
OMA 1 1.010
OrthoDB 1 1.010 D324834at33208
OrthoFinder 1 1.000 FOG0002051
OrthoInspector 1 1.000 T618748
orthoMCL 1 0.900 OOG5_129444
Panther 1 1.100 O PTHR14398
Phylome 1 0.910 0.667 Consistency score
TreeFam 1 0.960
1211.770

Return to query results.
Submit another query.