DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: swm and SPBC902.04

Sequence 1:NP_001260586.1 Gene:swm FlyBaseID:FBgn0002044 Length:1063 Species:Drosophila melanogaster
Sequence 2:NP_595202.1 Gene:SPBC902.04 PomBaseID:SPBC902.04 Length:589 Species:Schizosaccharomyces pombe

Alignment Length:1061 Identity:178/1062 (17%)
Similarity:303/1062 (29%) Gaps:526/1062 (50%)


  Fly     4 ENSDKLKDWLSVVLEPLCDADSSALARYVIALLKKDKSDKDLKRIMIEQLDVFLSEETTRFVERL 68
            |:::.||.:|...|||:.|||:|.|:.|.:|||:.|.|:::::::...||:.||.:||..||:::
pombe     7 EHAEYLKRYLEQALEPISDADASVLSDYAMALLRHDSSEEEVRQLCYSQLEDFLRQETIPFVDKI 71

  Fly    69 FDAIASEEYLTVPAAPLITASSASTAELTVDQELALVIDGPQDDIEAVLVADSPPPPPKDNVIKP 133
            ||.:..:.||                                                       
pombe    72 FDVLREKSYL------------------------------------------------------- 81

  Fly   134 DSNQVKLEQASQDAREAEALAFISQEAGIAMHVPTDAKPAFDQHKTKDSHNQQSASNYQHHHVRS 198
                                                                :.|||..      
pombe    82 ----------------------------------------------------EGASNMP------ 88

  Fly   199 ASPPGRSSGVSGSGGGGPGGAGLAAGYADKENQPRDSRRRRASLRSRSRSRSRSNERAFRRSRSR 263
                  |:|:                                                       
pombe    89 ------STGM------------------------------------------------------- 92

  Fly   264 DRRVNEREKTQRQFRNKSPPGSQTDNRHHGRRNFDRRRIGGNADDRPRFGNNKSRRSHSRSMSPE 328
               |.|                                             ..||.|.:.||.|.
pombe    93 ---VTE---------------------------------------------EVSRYSPTSSMIPA 109

  Fly   329 RNARRNQNSPDRVQTAQANLIPAPV----APPAPVEHPASHPRQRCRDFDEKGYCVRGETCPWDH 389
            .|:.....:.......:.|..|:.|    .|  |:.|||:                   |.|   
pombe   110 TNSMETNFNNSLPAVGKTNTFPSQVPNMFGP--PLYHPAA-------------------TAP--- 150

  Fly   390 GVNPVVFEGINNTSLMMSMREYNPDAPEIWARSGGPPPGAGQGPVPPPTQPGQTTINPFSGNVRP 454
                               .|:.|..|             |.|.:|                   
pombe   151 -------------------SEFMPSIP-------------GFGNLP------------------- 164

  Fly   455 TTLMSGSGPSPMGVPNPADYARNPGAPPQAAMMPF-PFNPTAVTTPLQRQLIPIPVVDGAPTGGV 518
                                  ||..||    :|| ||||.|..        |.|     |...:
pombe   165 ----------------------NPAMPP----IPFLPFNPAAQP--------PFP-----PPFKM 190

  Fly   519 AEVGKRRFELEDTVAIADVPTKRKVPINSRLGP-RVNPNMQQH--------------NSSLELRK 568
            .  |||.|.:...   .:...:|..|.|.|..| :..|  |.|              :::||:|.
pombe   191 R--GKRGFGMRHE---HNSELRRHSPGNRRFNPYKAYP--QPHLGHRFSRNAGNDPTSTALEVRN 248

  Fly   569 VPRGLNTIAHLNNHFAKFGKIVNIQVSYEGDP--EAAIVTFSTHAEANVAYRSTEAVLNNRFIKV 631
            :|.......::.:.|:|||.:..:::    :|  .:.::.|::|..||.|:.|.|.:.||||||:
pombe   249 IPEEHFNEENIRSFFSKFGVLEKVEL----NPTHHSCVLEFTSHEAANNAWSSPEPIFNNRFIKI 309

  Fly   632 FWHNDSSGADVGQMNQMGGGGGGGGRKNASQYHLHNVPAVPTPNADGAKISNANPLTEAGAGNIG 696
            ||:|.|.|                         .||.|         .|.::....|.:.:.|: 
pombe   310 FWYNPSKG-------------------------FHNRP---------KKFASHKSPTTSDSSNV- 339

  Fly   697 TPATEQANTAAPASMRLKLNTTTAGGSAGGAAGAGAPGSGRPLNPAANAASIRKKQEEQQKAVHQ 761
                |.:....|||:                           |........|.::|.:.::.:.:
pombe   340 ----ESSEDVDPASL---------------------------LQNEEFHKLIEERQRQHEERLKR 373

  Fly   762 L-AN-----GLRKRKQELLQSYMKQMKTALELVERMDQQDPQRAPTLQTIKVLQMTIDKLRKEIK 820
            : ||     .|.::|:||.|..:|:.:..::.::..|:...:|...|:|...|          :|
pombe   374 INANKKALEELNQKKRELAQQQLKEQELLMQKIKETDRSGNKRLMLLETQHSL----------LK 428

  Fly   821 ADQDQLQAQMQQQQQQQQPPVKKTKEQQKKELLDMELELIAQQQEGNDTTAIQKRLEELQRNLGV 885
            |:.|.|..           ||....|                                       
pombe   429 AEADCLGL-----------PVSNVSE--------------------------------------- 443

  Fly   886 GSAANNKSTHYAPASGAPGGGA-------GRKRPNLPEGPTRVDRRPKAIVVTGFAAEEAD---- 939
             |.|.:..:|:..|||.|..|.       ||.|.:: .....:|.||..:.|...:.|:.:    
pombe   444 -SPAASNGSHHPYASGLPQRGTNTFFRGRGRGRGDM-FASMSIDNRPTKLRVINVSPEKNEALLQ 506

  Fly   940 --FVLGHFKNFGEISKHDVDREIPQLILSYATRLNAEQ--AVLRGKMYKDKRLQISWAPVVTPAP 1000
              |.:|.::...|.|       ..:.::|:..|.:||:  ..:| .:.|.:.|:::|.|......
pombe   507 YLFTVGGYEEITEPS-------TTERLISFQNRNSAEKFFGGVR-NVEKLQELELAWVPKTAVTT 563

  Fly  1001 APMAAPVEKSAAPGDMSVSLE 1021
            ...:....:|....:|::.:|
pombe   564 NTTSMETGESNTSDNMNIEVE 584

Known Domains:


GeneSequenceDomainRegion External IDIdentity
swmNP_001260586.1 RRM1_RBM26_like 561..634 CDD:240703 24/75 (32%)
RRM2_RBM26_like 921..992 CDD:240704 16/79 (20%)
SPBC902.04NP_595202.1 PWI 12..75 CDD:295364 27/63 (43%)
RRM1_RBM26_like 241..312 CDD:240703 24/75 (32%)
NAM-associated 299..432 CDD:291001 40/209 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 132 1.000 Inparanoid score I1393
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002051
OrthoInspector 1 1.000 T1125335
orthoMCL 1 0.900 OOG5_129444
Panther 1 1.100 LDO PTHR14398
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3653
TreeFam 00.000 Not matched by this tool.
66.080

Return to query results.
Submit another query.