DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: swm and Rbm27

Sequence 1:NP_001260586.1 Gene:swm FlyBaseID:FBgn0002044 Length:1063 Species:Drosophila melanogaster
Sequence 2:XP_006525926.1 Gene:Rbm27 MGIID:2147194 Length:1060 Species:Mus musculus

Alignment Length:1302 Identity:329/1303 (25%)
Similarity:507/1303 (39%) Gaps:481/1303 (37%)


  Fly     1 MILENSDKLKDWLSVVLEPLCDADSSALARYVIALLKKDKSDKDLKRIMIEQLDVFLSEETTRFV 65
            |::|:.|.||.||:.:|||:||||.||||.||:||:||||.:|:||....:||||||.:||:.||
Mouse     1 MLIEDVDALKSWLAKLLEPICDADPSALANYVVALVKKDKPEKELKAFCADQLDVFLQKETSGFV 65

  Fly    66 ERLFDAIASEEYLTVPAAPLITASSASTAELTVDQELALVIDGPQDDIEAVLVADSPPPPPKDNV 130
            ::||:::.::.||. |..|:                                   .|.|.|    
Mouse    66 DKLFESLYTKNYLP-PLEPV-----------------------------------KPEPKP---- 90

  Fly   131 IKPDSNQVK---LEQASQDAREAEALAFISQEAGIAMHVPTDAKPAFDQHKTKDSHNQQSA-SNY 191
            :..:..::|   .::.:::.|:.....:.|         |..::....:.:|::...:... .:|
Mouse    91 LVQEKEEIKEEVFQEPAEEERDTRKKKYPS---------PQKSRSESSERRTREKKREDGKWRDY 146

  Fly   192 QHHHVRSASPPGRSSGVSGSGGGGPGGAGLAAGYADKENQPRDSRRRRASLRSRSRSRSRSNERA 256
            :.::.|:..                        |.:|    .|.||.|:..||:||..|||..|:
Mouse   147 ERYYERNEL------------------------YREK----YDWRRGRSKSRSKSRGLSRSRSRS 183

  Fly   257 FRRSRSRD--RRVNEREKTQ-RQFRN---------KSPPGSQTDNRHHGRRNF--------DRRR 301
            ..||:.||  |.|..||::: :..||         .:||.|.::....|.::.        ....
Mouse   184 RGRSKDRDPNRNVEHRERSKFKSERNDLESSYVPVSAPPPSSSEQYSSGAQSIPSTVTVIAPAHH 248

  Fly   302 IGGNADDRPRFGNNKSRRSHSRSMSPERNARRNQNSPDRVQTAQANLIPAPVAPPAPVEHPASHP 366
            .....:....:.||     ||.|.|..||                        ||         |
Mouse   249 SENTTESWSNYYNN-----HSSSNSFGRN------------------------PP---------P 275

  Fly   367 RQRCRDFDEKGYCVRGETCPWDHGVNPVVFEGINNTSLMMSMREYNPDAPEIWARSGGPPPGAGQ 431
            ::||||:||:|:||.|:.|.:|||.:|:|.:.:    .:.||..:.|           ||||   
Mouse   276 KRRCRDYDERGFCVLGDLCQFDHGNDPLVVDEV----ALPSMIPFPP-----------PPPG--- 322

  Fly   432 GPVPPPTQPGQTTINPFSG---NVRPTTLMSGSGPSPMGVPNPADYARNP-----GAPPQAAMMP 488
              :|||..||. .:.|..|   ...|     |.||.|...|.|....|.|     |.||.:.::|
Mouse   323 --LPPPPPPGM-LMPPMPGPGPGPGP-----GPGPGPGPGPGPGHSMRLPVPQGHGQPPPSVVLP 379

  Fly   489 FPFNPTAVTT-------------------------PLQRQLI----------------------- 505
            .|..|.:.::                         ||.:.|:                       
Mouse   380 IPRPPISQSSLINSRDQPGTSAVPNLAPVGARLPPPLPQNLLYTVSERQPMYSREHGAAASERLQ 444

  Fly   506 -------------------------------PIPVV------DG----APTGGVAEVGKRRF--- 526
                                           |.|:|      ||    ||:  :...|:.::   
Mouse   445 LGTPPPLLAARLVPPRNLMGSSIGYHTSVSSPTPLVPDTYEPDGYNPEAPS--ITSSGRSQYRQF 507

  Fly   527 -------------------ELEDTVAIADVPTKRKVPIN-------------SR----------- 548
                               :.....|...:.|:..||::             ||           
Mouse   508 FSRAQTQRPNLIGLTSGDMDANPRAANIVIQTEPPVPVSVNSNVTRVVLEPESRKRAISGLEGPL 572

  Fly   549 -----LGPRVNPNM-------QQH--NSSLELRKVPRGLNTIAHLNNHFAKFGKIVNIQVSYEGD 599
                 ||.:.|.|.       :.|  |:.||::|:|:.||.|..||.||:|||.||||||:::||
Mouse   573 TKKPWLGKQGNNNQSKPGFLRKNHYTNTKLEVKKIPQELNNITKLNEHFSKFGTIVNIQVAFKGD 637

  Fly   600 PEAAIVTFSTHAEANVAYRSTEAVLNNRFIKVFWHNDS-------SGADV--GQMNQMGGGGGGG 655
            ||||::.:.|:.||..|..|||||||||||:|.||.::       |.|.:  .|.:.:       
Mouse   638 PEAALIQYLTNEEARKAISSTEAVLNNRFIRVLWHRENNEQPALQSSAQILLQQQHTL------- 695

  Fly   656 GRKNASQYHLHNVP------------AVPT------------PNADGAKISNANPLTEAGAGNIG 696
              .:.||.| |::|            :.|:            |...||.:.|..|:..    .:|
Mouse   696 --SHLSQQH-HSLPQHLHPQQVMVTQSSPSSVHGGIQKMMGKPQTSGAYVLNKVPVKH----RLG 753

  Fly   697 TPATEQANTAAPASMRLKLNTTTAGGSAGGAAGAGAPGSGRPLNPAANAAS-------------- 747
            ..:|.|::|:.      .||.|      ||::|...|....|.:|....:|              
Mouse   754 HASTNQSDTSH------LLNQT------GGSSGEDCPVFSTPGHPKTIYSSSNLKAPSKLCSGSK 806

  Fly   748 -------IRKKQEEQQKAVHQLANGLRKRKQELLQSYMKQMKTALELVERMDQQDP-QRAPTLQT 804
                   ::||||..     :|...:||:|||:|:..::..|..:..:|:.....| :||..::|
Mouse   807 SHDVQEVLKKKQEAM-----KLQQDMRKKKQEMLEKQIECQKMLISKLEKNKNMKPEERANIMKT 866

  Fly   805 IKVLQMTIDKLRKEIKADQDQLQAQMQQQQQQQQPPVKKTKEQQKKELLDMELELIAQQQEGNDT 869
            :|.|...|.:|:.|:|.           ......|...|||.:.:|||||.||:|..:...|.||
Mouse   867 LKELGEKISQLKDELKT-----------SSTVSTPSKVKTKTEAQKELLDTELDLHKRLSSGEDT 920

  Fly   870 TAIQKRLEELQ---RNLGVGSAANNKSTHYAPASGAPGGGAGRKRPNLPEGPTRVDRRPKAIVVT 931
            |.::|:|.:||   ..||:......|:.    :|...|.|.||.|.........||.||||:...
Mouse   921 TELRKKLSQLQVEAARLGILPVGRGKTI----SSQGRGRGRGRGRGRGSLNHMVVDHRPKALPGG 981

  Fly   932 GFAAEEADFVLGHFKNFGEISKHDVDREIPQLILSYATRLNAEQAVLRGKMYKDKRLQISWAPVV 996
            ||..||.|.:|.||....:.||                             :||:||||||    
Mouse   982 GFIEEEKDELLQHFSATNQASK-----------------------------FKDRRLQISW---- 1013

  Fly   997 TPAPAPMAAPVEKSAAPGDMSVSLENPKQLIQSVSESESLLGSDTLPELRLEDEEEDEESEDRSW 1061
                       .|...|   |:|.|..::.::. .|:|:   ||..  |..:|:|:::|.|.|||
Mouse  1014 -----------HKPKVP---SISTETEEEEVKE-EETET---SDLF--LHDDDDEDEDEYESRSW 1058

  Fly  1062 RR 1063
            ||
Mouse  1059 RR 1060

Known Domains:


GeneSequenceDomainRegion External IDIdentity
swmNP_001260586.1 RRM1_RBM26_like 561..634 CDD:240703 44/73 (60%)
RRM2_RBM26_like 921..992 CDD:240704 23/71 (32%)
Rbm27XP_006525926.1 PWI 7..72 CDD:295364 39/65 (60%)
zf-CCCH 277..299 CDD:279036 13/22 (59%)
RRM_RBM27 599..674 CDD:240961 45/75 (60%)
FAM76 <749..883 CDD:292665 37/155 (24%)
RRM_SF 971..1013 CDD:302621 23/71 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C334642253
eggNOG 1 0.900 E1_KOG2135
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 374 1.000 Inparanoid score I2074
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D324834at33208
OrthoFinder 1 1.000 FOG0002051
OrthoInspector 1 1.000 T616628
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR14398
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3653
TreeFam 1 0.960
1211.900

Return to query results.
Submit another query.