DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: swm and rbm-26

Sequence 1:NP_001260586.1 Gene:swm FlyBaseID:FBgn0002044 Length:1063 Species:Drosophila melanogaster
Sequence 2:NP_001348728.1 Gene:rbm-26 WormBaseID:WBGene00015143 Length:721 Species:Caenorhabditis elegans

Alignment Length:1113 Identity:263/1114 (24%)
Similarity:390/1114 (35%) Gaps:447/1114 (40%)


  Fly     1 MILENSDKLKDWLSVVLEPLCDADSSALARYVIALLKK-DKSDKDLKRIMIEQLDVFLSEETTRF 64
            |.::|.|.|.||||..|.|:.|||.:|||:||:||:|| ||...:||....|||:|||::.|..|
 Worm     1 MHIDNEDALFDWLSDELSPITDADPNALAKYVLALVKKPDKGHDELKAFTNEQLNVFLTDHTAPF 65

  Fly    65 VERLFDAIASEEYLTVPAAPLITASSASTAELTVDQELALVIDGPQDDIEAVLVADSPPPPPKDN 129
            |:::|:|:.|:.|:....||  |::||:..:|..::..|   :.|          ..|..||   
 Worm    66 VDKVFEALTSKSYMPASTAP--TSASATAPDLKKEKAPA---EKP----------SKPTAPP--- 112

  Fly   130 VIKPDSNQVKLEQASQDAREAEALAFISQEAGIAMHVPTDAKPAFDQHKTKDSHNQQSASNYQHH 194
                   .|:...:|..|.:||                  ::|.                     
 Worm   113 -------GVQKSSSSPSASKAE------------------SRPL--------------------- 131

  Fly   195 HVRSASPPGRSSGVSGSGGGGPGGAGLAAGYADKENQPRDSRRRRASLRSRSRSRSRSNERAFRR 259
            ..|.:.||..:                    .:||.|.||..||          ||||       
 Worm   132 RKRISPPPSEN--------------------REKEKQSRDKERR----------RSRS------- 159

  Fly   260 SRSRDRRVNEREKTQRQFRNKSPPGSQTDNRHHGRRNFDRRRIGGNADDRPRFGNNKSRRSHSRS 324
              .||||  .|..|.|..|..|   |..| ||..||:                      ||.|||
 Worm   160 --PRDRR--GRATTSRSGRTSS---SDRD-RHSKRRS----------------------RSRSRS 194

  Fly   325 MSPERNARRNQNSPDRVQTAQANLIPAPVAPPAPVEHPASHPRQRCRDFDEKGYCVRGETCPWDH 389
            .|..|                        .||    :.:...|:||:||:|:|||:||:.||:.|
 Worm   195 SSGSR------------------------TPP----YKSRSSRRRCKDFEERGYCIRGDQCPYYH 231

  Fly   390 GVNPVVFE------------GINNTSLMMSMREYNPDAPEIWARSGGPPPG----AG----QGP- 433
            |.:|||.:            ...|.|..:....|||..|        ||||    ||    :.| 
 Worm   232 GRDPVVVDENALGSMVPLPATAPNFSCSLPPPGYNPLNP--------PPPGVVVAAGEYNPEAPA 288

  Fly   434 -----VPPPTQPGQTTINPFSGNVRPTTLMSGSGPSPMGVPNPADYARNPGAPPQAAMMPFPFNP 493
                 :|||..|||......:....|.::.|.|.|                 ||.||.       
 Worm   289 LNNYSIPPPPIPGQWQQPHVAAQYVPQSVSSYSQP-----------------PPAAAQ------- 329

  Fly   494 TAVTTPLQRQLIPIPVVDGAP--------TGGVAEVGKRRFELEDTVAIADVPTKRKVPINSRLG 550
            ..||.|...:        |||        .||.|..|       .|.||                
 Worm   330 GVVTQPGSFR--------GAPRGRGNIRGRGGFARGG-------FTGAI---------------- 363

  Fly   551 PRVNPNMQQHNSSLELRKVPRGLNTIAHLNNHFAKFGKIVNIQVSYEGDPEAAIVTFSTHAEANV 615
                   .:.|.:|::.|:|..:||||.||.|||.||.:.||||.|.|:.::|:||:::..:|..
 Worm   364 -------NRDNCTLQVAKIPPEMNTIAKLNEHFATFGTVDNIQVRYNGEIDSALVTYASKFDAGK 421

  Fly   616 AYRSTEAVLNNRFIKVFWHNDSSGADVGQMNQMGGGGGGGGRKNASQYHLHNVPAVPTPNADGAK 680
            ||:|...|||||||||||||.                ||.|.:||                    
 Worm   422 AYKSPTPVLNNRFIKVFWHNP----------------GGEGSENA-------------------- 450

  Fly   681 ISNANPLTEAGAGNIGTPATEQANTAAPASMRLKLNTTTAGGSAGGAAGAGAPGSGRPLNPAANA 745
                                                                  :|:|.:|.:..
 Worm   451 ------------------------------------------------------TGKPSSPTSPP 461

  Fly   746 ASIRKKQ---EEQQKAVHQLANGLRKRKQELLQSYMKQMKTALELVERMDQQDPQRAPTLQTIKV 807
            ..:.|.:   .::.|.|...|...||:.|:..:...|:......||:..:|.:            
 Worm   462 KPVEKPKIATVQESKFVSVAAQNYRKQIQDAKERLTKEKSILSTLVQAQNQHN------------ 514

  Fly   808 LQMTIDKLRKEIKADQDQLQAQMQQQQQQQQPPVKKTKEQQK-----KELLDMELELIAQQQEGN 867
              :.:||..  :|..:..::|:....:..::...|..|...|     ||.:|..|..|:::....
 Worm   515 --IILDKWM--VKQKELLIKARTSTDETDKKNATKLVKHLHKKIKACKEEVDGILLKISEKSMVV 575

  Fly   868 DTTAIQKRLEELQRNLGVGSAANNKSTHYAPASGAPGGGAGRKRPNLPEGPTRVDRRPKAIVVTG 932
            |..|.|  :|||:     ....::.||              |||....:|.....:....::|.|
 Worm   576 DEIAAQ--IEELK-----NPQKSDDST--------------RKRKAGSDGDEPQSKMSSVVIVRG 619

  Fly   933 FAAEEADFVLGHFKNFGEISKHDVDREIPQLILSY--------ATRLNAEQAVLRGKMYKDKRLQ 989
            ...|....::.|.:.|||:..|.|..:...||.:.        |.:..|:..||.|         
 Worm   620 VTDELVTDLMAHMEKFGEVFDHSVKADDDGLITAVFPFRKTGDALKAMADGKVLNG--------- 675

  Fly   990 ISWAPVVTPAPAPMAAPVEKSAAPGDMSVSLENPKQLIQSVSESESLLGSDTL----PELRLEDE 1050
                                      :.:.:|...:.|:.:..:::.:.:|.|    |. .||.:
 Worm   676 --------------------------VDLEMELKTERIEEIPSTDTNMSADQLLAAIPS-NLESD 713

  Fly  1051 EEDEESED 1058
            |||:...|
 Worm   714 EEDDLLND 721

Known Domains:


GeneSequenceDomainRegion External IDIdentity
swmNP_001260586.1 RRM1_RBM26_like 561..634 CDD:240703 39/73 (53%)
RRM2_RBM26_like 921..992 CDD:240704 16/79 (20%)
rbm-26NP_001348728.1 PWI 12..77 CDD:321990 33/65 (51%)
zf-CCCH 209..233 CDD:279036 15/24 (63%)
GGN <250..>337 CDD:330621 30/119 (25%)
RRM1_RBM26_like 367..440 CDD:240703 39/73 (53%)
RRM_SF 612..666 CDD:327398 12/54 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C334608474
eggNOG 1 0.900 E1_KOG2135
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 172 1.000 Inparanoid score I2708
Isobase 1 0.950 0 Normalized mean entropy S7344
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D324834at33208
OrthoFinder 1 1.000 FOG0002051
OrthoInspector 1 1.000 T476508
orthoMCL 1 0.900 OOG5_129444
Panther 1 1.100 LDO PTHR14398
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3653
TreeFam 1 0.960
1211.740

Return to query results.
Submit another query.