DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: swm and rbm27

Sequence 1:NP_001260586.1 Gene:swm FlyBaseID:FBgn0002044 Length:1063 Species:Drosophila melanogaster
Sequence 2:XP_002935312.2 Gene:rbm27 XenbaseID:XB-GENE-6037527 Length:1007 Species:Xenopus tropicalis

Alignment Length:1199 Identity:335/1200 (28%)
Similarity:511/1200 (43%) Gaps:328/1200 (27%)


  Fly     1 MILENSDKLKDWLSVVLEPLCDADSSALARYVIALLKKDKSDKDLKRIMIEQLDVFLSEETTRFV 65
            |::||.|..|.||:.:|||:||||..|||.|||||:|||||:|:||.|..:||||||.:||..||
 Frog     1 MLIENVDAFKTWLAKLLEPICDADPMALANYVIALVKKDKSEKELKAICADQLDVFLQKETNGFV 65

  Fly    66 ERLFDAIASEEYLTVPAAPLITASSASTAELTVDQELALVIDGPQDDIEAVLVADSPPPPPKDNV 130
            :::||::.::.||  |....|.|.        :.||        :::|:..:....|.|.|....
 Frog    66 DKMFDSLHTKVYL--PPEETINAD--------LKQE--------KEEIKEEVPEKRPMPTPGMET 112

  Fly   131 IKPDSNQVKLEQASQDAREAEALAFISQEAGIAMHVPTDAK-PAFDQHKTKDSHNQQSASNYQHH 194
            .:.:.:..|.:..|.....::     |.|..|......|.| ..:|:|:.|          |...
 Frog   113 YEEERDSRKKKHPSPPRNRSD-----SSERRIREKKREDGKYREYDRHRDK----------YDWR 162

  Fly   195 HVRSASPPGRSSGVSGSGGGGPGGAGLAAGYADKENQPRDSRRRRASLRSRSRSRSRSNERAFRR 259
            ..||.||                                  .:.:::.|||||||.||.||...|
 Frog   163 RGRSKSP----------------------------------TKSKSTNRSRSRSRGRSRERESTR 193

  Fly   260 SRSRDRRVNEREKTQRQFRNKSPPGSQTDNRHHGRRNFDRRRIGGNADDRPRFGNNKSRRSHSRS 324
            :|.     |.:..:.:|        |.:.::|..|:.|:..|:...|...|        .|.|.:
 Frog   194 NRG-----NAKGNSVQQ--------SSSASQHRERQKFESERMELEAAYTP--------SSQSSA 237

  Fly   325 MSPERNARRNQNSPDRVQTAQANLIPAPVAPPAPVEHPAS-----------H-----------PR 367
            :|.|:.           .::....||:.|...||..||.|           |           |:
 Frog   238 ISAEQQ-----------YSSGGQAIPSTVTVIAPAHHPESTTEIWSNYYNNHNPPNSFSRIPPPK 291

  Fly   368 QRCRDFDEKGYCVRGETCPWDHGVNPVVFEGINNTSLMMSMREYNPDAPEIWARSGGPPPGAGQG 432
            :||||:||:|:||.|:.|.:|||.:|:|.:.::..|::       |..|.    .|.||||....
 Frog   292 RRCRDYDERGFCVLGDLCQYDHGNDPLVVDEVSLPSMI-------PFPPP----PGLPPPGILLP 345

  Fly   433 PVPPPT-QPGQTTINPFSGNVRPTTLMSGSGPSP-MGVPNPAD-YARNP---------GAPPQAA 485
            |:|.|. ......:.|.:....|..|.:.|.|.| .|:.|..| .|.|.         |.||:  
 Frog   346 PIPDPAHNMRMPVLRPHNQPPPPAVLPAPSLPLPHSGLLNNRDRLATNTVPSLAPIVGGLPPR-- 408

  Fly   486 MMPFP---------------FNPTAVT----------TPLQRQLIPIPVVDGAPTGGVAEVGKRR 525
             :|.|               :||.|.:          |.||||          ||.....:|...
 Frog   409 -IPPPNLLYSVSEHTYEPDGYNPEAPSLTNTGRPGYRTFLQRQ----------PTQRSNLIGLTS 462

  Fly   526 FELEDTVAIADVPTKRKVP-----------INSRL--------------GP---------RVNPN 556
            .:::.....|::..:.:.|           :|:|:              ||         :.|.|
 Frog   463 CDMDTAPRAANIVIQTEPPPPPPPPSTVGVVNNRVVVEPDRKRTAGNMDGPFAKKPWMDKQGNHN 527

  Fly   557 ---------MQQHNSSLELRKVPRGLNTIAHLNNHFAKFGKIVNIQVSYEGDPEAAIVTFSTHAE 612
                     :|..|:.||:||:|:.||.|..||.||:|||.||||||:::||||.|::.:.|:.|
 Frog   528 HNKTGFVKKIQYTNTKLEVRKIPQDLNNITKLNEHFSKFGTIVNIQVAFQGDPEGALIQYLTNDE 592

  Fly   613 ANVAYRSTEAVLNNRFIKVFWHNDSSGADVGQMNQ------------MGGGGGGGGRK------N 659
            |..|..|||||||||||:|.||.:::.....|..|            :...|.|..:|      |
 Frog   593 ARRAISSTEAVLNNRFIRVLWHRENNEQQHTQPQQHHLTTASTTQTPIAPAGQGHLQKVIPKAIN 657

  Fly   660 ASQYHLHNVPAVPTPNADGAKISNANPLTEAGAGNIGTPATEQANTAAPASMRLKLNTTTAGGSA 724
            ...|.|:.:|    |.....:.|::...|...|.|  .|::.:.|...|.|..|.....::|   
 Frog   658 QGSYVLNKLP----PKQRLGQTSSSPSDTTYLASN--QPSSGEENQTLPPSTSLSKMVYSSG--- 713

  Fly   725 GGAAGAGAPGSGRPLNPAANA---ASIRKKQEEQQKAVHQLANGLRKRKQELLQSYMKQMKTALE 786
                  |...|.:|..|:...   .:::||||     ..:|...:||:|||:|:   ||::....
 Frog   714 ------GLKTSNKPAAPSKTVDVQDALKKKQE-----ALKLQQDMRKKKQEMLE---KQIECQKM 764

  Fly   787 LVERMDQ----QDPQRAPTLQTIKVLQMTIDKLRKEIKADQDQLQAQMQQQQQQQQPPVKKTKEQ 847
            |:.|:::    :..:|...::|:|.|...|.:::.|:|.    |.|          |...|:|.:
 Frog   765 LISRLEKNKSMKAEERTEIMKTLKTLDEKISQVKDELKT----LSA----------PSKLKSKTE 815

  Fly   848 QKKELLDMELELIAQQQEGNDTTAIQKRLEELQ---RNLGVGSAANNKSTHYAPASGAPGGGAGR 909
            .:|||||.|::...:...|.|||.::|:|..||   ..||:...:..|:        .||...||
 Frog   816 AQKELLDAEMDFHKRLSSGEDTTELRKKLSLLQVEAARLGILPPSRGKT--------LPGQSRGR 872

  Fly   910 KRPNLPEGPTR-----VDRRPKAIVVTGFAAEEADFVLGHFKNFGEISKHDVDREIPQLILSYAT 969
            .|.:...|...     ||.|||.|.|.||..:|.:.:|.||..||::.....:...|.:||::.|
 Frog   873 GRGHGTRGRGSLSHMVVDHRPKTISVVGFYDKEKEELLQHFAKFGDVEDLKEEEFPPSVILTFKT 937

  Fly   970 RLNAEQAVLRGKMYKDKRLQISWAPVVTPAPAPMAAPVEKSAAPGDMSVSLENPKQLIQSVSESE 1034
            |..||.|..:|..:|.::||:||....||:                :|..:|..:...:....|:
 Frog   938 RQEAENAANQGSKFKGRKLQVSWHKPKTPS----------------ISTEIEEDETKEEEAETSD 986

  Fly  1035 SLLGSDTLPELRLEDEEEDEESEDRSWRR 1063
            ..|..|       |||:|||: |.|||||
 Frog   987 PFLHDD-------EDEDEDED-ESRSWRR 1007

Known Domains:


GeneSequenceDomainRegion External IDIdentity
swmNP_001260586.1 RRM1_RBM26_like 561..634 CDD:240703 44/73 (60%)
RRM2_RBM26_like 921..992 CDD:240704 28/71 (39%)
rbm27XP_002935312.2 PWI 7..72 CDD:295364 40/65 (62%)
RRM_RBM27 541..616 CDD:240961 45/75 (60%)
DUF342 <733..820 CDD:302792 29/109 (27%)
RRM_SF 889..960 CDD:302621 28/71 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C334642123
eggNOG 1 0.900 E1_KOG2135
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D324834at33208
OrthoFinder 1 1.000 FOG0002051
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
76.720

Return to query results.
Submit another query.