DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: swm and rbm27

Sequence 1:NP_001260586.1 Gene:swm FlyBaseID:FBgn0002044 Length:1063 Species:Drosophila melanogaster
Sequence 2:XP_005167991.1 Gene:rbm27 ZFINID:ZDB-GENE-110411-31 Length:1031 Species:Danio rerio

Alignment Length:1231 Identity:344/1232 (28%)
Similarity:496/1232 (40%) Gaps:368/1232 (30%)


  Fly     1 MILENSDKLKDWLSVVLEPLCDADSSALARYVIALLKKDKSDKDLKRIMIEQLDVFLSEETTRFV 65
            ||::|.|.||.||:.:|||:||||.||||.||:||:||||.:|:|:.:..:||||||.:|||.||
Zfish     1 MIIDNVDALKSWLAKLLEPICDADPSALANYVVALVKKDKPEKELRALCADQLDVFLQKETTGFV 65

  Fly    66 ERLFDAIASEEYLTVPAAPLITASSASTAELTVDQELALVIDGPQDDIEAVLVADSPPPPPKDNV 130
            ::||:.:.::.||..||               |.:|:.:.:.                       
Zfish    66 DKLFECLTTKNYLGPPA---------------VKEEVKIPVQ----------------------- 92

  Fly   131 IKPDSNQVKLEQASQDAREAEALAFISQEAGIAMHVPTDA-----------KPAFDQHKTKDSHN 184
                    |||:..:.|                 ||..|.           :..|::.:.:|...
Zfish    93 --------KLEEKEETA-----------------HVEDDRENRRRRSPLRNRSDFNESRARDDRR 132

  Fly   185 QQSASNYQ-HHHVRSASPPGRSSGVSGSGGGGPGGAGLAAGYADKENQPRDSRRRRASLRSRSRS 248
            :......: ..|::|    |.|                   |.|:.      .||..|.|.||.|
Zfish   133 RDDRKRREVDRHLKS----GES-------------------YRDRH------ERRGGSSRGRSYS 168

  Fly   249 RSRSNERAFRRSRSRDRRVNEREKTQRQFRNKSPPGSQTDNRHHGRRNFDRRRIGGNADDRPRFG 313
            ||||..|:..|.:||:|..|:|                   |...|..|::.|            
Zfish   169 RSRSRSRSGSRGKSREREHNQR-------------------RAEHRSKFEQER------------ 202

  Fly   314 NNKSRRSHSRSMSPERNARRNQNSPDRVQTAQANLIPAPV-----------APP------APVEH 361
                     :...|...:..:.::|...||....|:|.|:           |.|      |||..
Zfish   203 ---------KEAEPYNPSSAHMSNPHHQQTHPPPLLPLPLPQHQFPSSGSPAVPKAATVVAPVHL 258

  Fly   362 PAS-----------HP-----------RQRCRDFDEKGYCVRGETCPWDHGVNPVVFEGINNTSL 404
            |.|           |.           :.||||:||||:|:||:.||:|||.:|::.:.:...::
Zfish   259 PDSTTESWSAYFTNHSDGKTFNKSNTLKHRCRDYDEKGFCIRGDLCPFDHGNDPLIVDDVTLPTM 323

  Fly   405 M----------MSMREYNPDAPEIWARSGGPPPGAGQGPVPPPTQPGQTTINPFSGN------VR 453
            :          |.|    |...|       ||||... |:||..||....|.|....      .|
Zfish   324 IPFPPPPALPRMPM----PPMTE-------PPPGMPM-PLPPHGQPPPPGIYPMPAGGPPAILSR 376

  Fly   454 PTTLMSGSGP-------------------SPMGVPNPADYARNPGAP--------------PQAA 485
            ||..:..:||                   ||:.:|.... ..||..|              ||..
Zfish   377 PTGGLLPTGPPLIPATGIDTPPHSRTTTSSPLALPGVGP-PPNPPPPLPPSSSSSSSASLHPQYT 440

  Fly   486 MMPFPFNPTA-------VTTP-----------LQRQ---LIPIPVVDG------------APTGG 517
            :..:.::|.|       :|.|           :|.|   ||.:...||            .|:..
Zfish   441 LSEYNYDPEAYNPESPGLTGPGRAQYRHFIPRIQTQRPNLIGLTSGDGLNSRAANIVIQTEPSVT 505

  Fly   518 VAEVGKRRFELEDTVAIADVPTKRKVPINSRLGPRV------NPNM-QQH-----------NSSL 564
            .....:.||..|.        ..||..:.|..||:|      .||. .||           |:.|
Zfish   506 SVSNSEMRFNSEQ--------ENRKRCLPSTDGPQVKKPWMDKPNFNNQHKPTFPKKHYYVNTKL 562

  Fly   565 ELRKVPRGLNTIAHLNNHFAKFGKIVNIQVSYEGDPEAAIVTFSTHAEANVAYRSTEAVLNNRFI 629
            |:|::||.||.|..||.||:|||.||||||.:.||||||::.::.:.||..|..|||||||||||
Zfish   563 EVRRIPRELNNITKLNEHFSKFGTIVNIQVVFGGDPEAALIQYTANDEARRAISSTEAVLNNRFI 627

  Fly   630 KVFWHNDSSGADVGQMNQMGGGGGGGGRKNASQYH--LHNVPAVPTPNADGAKISNANPLTEAGA 692
            :|:||.:.:.....|        |.....|..|.|  .|.|.....|.|... ::...|...|..
Zfish   628 RVYWHREPTANTQEQ--------GPSQSTNPGQQHPPTHKVINKQHPAASYV-LNKTIPKHHAAT 683

  Fly   693 GNIG-TPATEQANTAAPASMRLKLNTTTAGGSAGGAAGAGAPGSGRPLNPAANAASIRKKQEEQQ 756
            |..| |.:||..:.:...|:.|...::...|.........|..|......|..|....||::|..
Zfish   684 GTAGITGSTEPTSPSQEPSVGLTPPSSLVKGPFSRTVLKAASKSLGKTGKALEAQEALKKKQEAL 748

  Fly   757 KAVHQLANGLRKRKQELLQSYMKQMKTALELVERMDQQDP-QRAPTLQTIKVLQMTIDKLRKEIK 820
            |    |...:||:|||:|:..::..|..:..:|:.....| :||..::|:|.|...|.:|:.||.
Zfish   749 K----LQQDMRKKKQEMLEKQIECQKVLINRLEKNRGMKPEERANIMKTLKELTEKISQLKNEIS 809

  Fly   821 ADQDQLQAQMQQQQQQQQPPVKKTKEQQKKELLDMELELIAQQQEGNDTTAIQKRLEELQ---RN 882
            .     .||......|     .|:|...:|||||.||:...:...|.|||.:::||.:||   ..
Zfish   810 P-----TAQATANTTQ-----SKSKTDAQKELLDAELDFHKKLTSGEDTTDLKRRLGQLQVEATR 864

  Fly   883 LGVGSAANNKSTHYAPASGAPGGGAGRKRPNLPEGPTR---VDRRPKAIVVTGFAAEEADFVLGH 944
            ||:..|...|.: .||..|.   |.||.|.....|...   ||.||:|:.:.||..||.:.::.|
Zfish   865 LGLIPAGRGKPS-LAPTRGR---GRGRGRNLRGRGGANHMVVDHRPRALSIIGFTQEEKEELMPH 925

  Fly   945 FKNFGEIS---KHDVDREIPQLILSYATRLNAEQAVLRGKMYKDKRLQISW----APVVTPAPAP 1002
            |..||||.   :||..    .:::::.||.:||.|..:|..:|.:.|||||    .|.|:..|..
Zfish   926 FVKFGEIEELREHDAS----SVVMTFKTRSDAENAANQGAKFKGRILQISWYKPKTPSVSTEPEE 986

  Fly  1003 MAAPVEKSAAPGDMSVSLENPKQLIQSVSESESLLGSDTLPELRLEDEEEDEESEDRSWRR 1063
            ..:..|.:||.             |..::|..|..   .|||...||::||:|.|.|||||
Zfish   987 EESKEEVNAAG-------------IHVMTEPVSPF---LLPEEEEEDDDEDDEYESRSWRR 1031

Known Domains:


GeneSequenceDomainRegion External IDIdentity
swmNP_001260586.1 RRM1_RBM26_like 561..634 CDD:240703 44/73 (60%)
RRM2_RBM26_like 921..992 CDD:240704 28/74 (38%)
rbm27XP_005167991.1 PWI 7..72 CDD:295364 39/65 (60%)
zf-CCCH 288..309 CDD:279036 15/21 (71%)
RRM <500..>673 CDD:223796 68/190 (36%)
RRM_SF 559..634 CDD:302621 45/75 (60%)
DUF4200 736..809 CDD:290574 24/77 (31%)
RRM_SF 902..972 CDD:302621 28/74 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C334652326
eggNOG 1 0.900 E1_KOG2135
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 353 1.000 Inparanoid score I2187
OMA 1 1.010
OrthoDB 1 1.010 D324834at33208
OrthoFinder 1 1.000 FOG0002051
OrthoInspector 1 1.000 T597499
orthoMCL 1 0.900 OOG5_129444
Panther 1 1.100 LDO PTHR14398
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3653
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1312.800

Return to query results.
Submit another query.