DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: RtcB and rtcb

Sequence 1:NP_609965.1 Gene:RtcB FlyBaseID:FBgn0032781 Length:506 Species:Drosophila melanogaster
Sequence 2:NP_001025674.1 Gene:rtcb XenbaseID:XB-GENE-974751 Length:505 Species:Xenopus tropicalis

Alignment Length:503 Identity:422/504 (84%)
Similarity:464/504 (92%) Gaps:0/504 (0%)


  Fly     4 RPYNDELRYLEKVSDHCWRIKKGFQPNMNVEGCFYVNSRLERLMLEELKNSCRPGAVGGFLPGVK 68
            |.|||||:||:|:..:||||:|||.|||.|||.||||..||:||.|||:|:.|.||.|||||.:|
 Frog     3 RSYNDELQYLDKIHKNCWRIRKGFVPNMQVEGVFYVNDPLEKLMFEELRNASRGGAAGGFLPAMK 67

  Fly    69 QIANVAALPGIVGRSIGLPDIHSGYGFAIGNMAAFDMNDPLSVVSPGGVGFDINCGVRLLRTNLY 133
            ||.||||||||:.|||||||:||||||||||||||||::|.:||||||||||||||||||||||.
 Frog    68 QIGNVAALPGIIHRSIGLPDVHSGYGFAIGNMAAFDMDNPEAVVSPGGVGFDINCGVRLLRTNLD 132

  Fly   134 EKDVQPVKEQLAQSLFDHIPVGVGSKGIIPMNARDLEEALEMGMDWSLREGYVWAEDKEHCEEYG 198
            |.|||||||||||::||||||||||||:|||.|:|||||||||:||||||||.||||||||||||
 Frog   133 ESDVQPVKEQLAQAMFDHIPVGVGSKGVIPMGAKDLEEALEMGVDWSLREGYAWAEDKEHCEEYG 197

  Fly   199 RMLNADPAKVSMRAKKRGLPQLGTLGAGNHYAEIQVVDEIYDKWSASKMGIEEKGQVVVMIHSGS 263
            |||.|||:|||.:||||||||||||||||||||:||||:|||:::|.||||:.||||.|||||||
 Frog   198 RMLQADPSKVSSKAKKRGLPQLGTLGAGNHYAEVQVVDDIYDEYAAKKMGIDHKGQVCVMIHSGS 262

  Fly   264 RGFGHQVATDALVQMEKAMKRDKIETNDRQLACARINSVEGQDYLKAMAAAANFAWVNRSSMTFL 328
            ||.||||||||||.||||||||||..||||||||||:|.|||||||.||||.|:|||||||||||
 Frog   263 RGLGHQVATDALVAMEKAMKRDKITVNDRQLACARISSAEGQDYLKGMAAAGNYAWVNRSSMTFL 327

  Fly   329 TRQAFAKMFNTTPDDLDMHVIYDVSHNIAKVENHMVDGKERKLLVHRKGSTRAFPPHHPLIPVDY 393
            |||||:|:|||||||||:||||||||||||||.|:|||||:.|||||||||||||||||||||||
 Frog   328 TRQAFSKVFNTTPDDLDLHVIYDVSHNIAKVEQHVVDGKEKTLLVHRKGSTRAFPPHHPLIPVDY 392

  Fly   394 QLTGQPVLVGGTMGTCSYVLTGTEQGMQETFGSTCHGAGRALSRAKSRRNLDYKDVLDKLDQLGI 458
            ||||||||:||||||||||||||:|||.||||:|||||||||||||||||||::||||||..|||
 Frog   393 QLTGQPVLIGGTMGTCSYVLTGTDQGMTETFGTTCHGAGRALSRAKSRRNLDFQDVLDKLADLGI 457

  Fly   459 AIRVASPKLVMEEAPESYKDVTDVVDTCHAAGISKKCIKMRPIAVIKG 506
            |||||||||||||||||||:|||||:|||.||||||.||:||||||||
 Frog   458 AIRVASPKLVMEEAPESYKNVTDVVNTCHDAGISKKAIKLRPIAVIKG 505

Known Domains:


GeneSequenceDomainRegion External IDIdentity
RtcBNP_609965.1 RtcB 67..506 CDD:224604 379/439 (86%)
RtcB 67..506 CDD:279481 379/439 (86%)
rtcbNP_001025674.1 RtcB 68..505 CDD:307338 378/437 (86%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C159136840
eggNOG 1 0.900 E1_COG1690
Hieranoid 1 1.000
Homologene 1 1.000 H36344
Inparanoid 1 1.050 876 1.000 Inparanoid score I371
OMA 1 1.010
OrthoDB 1 1.010 D203128at33208
OrthoFinder 1 1.000 FOG0006447
OrthoInspector 1 1.000 T1060301
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2780
TreeFam 1 0.960
1211.800

Return to query results.
Submit another query.