DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: RtcB and RTCB

Sequence 1:NP_609965.1 Gene:RtcB FlyBaseID:FBgn0032781 Length:506 Species:Drosophila melanogaster
Sequence 2:NP_055121.1 Gene:RTCB HGNCID:26935 Length:505 Species:Homo sapiens

Alignment Length:503 Identity:430/504 (85%)
Similarity:464/504 (92%) Gaps:0/504 (0%)


  Fly     4 RPYNDELRYLEKVSDHCWRIKKGFQPNMNVEGCFYVNSRLERLMLEELKNSCRPGAVGGFLPGVK 68
            |.|||||::|||::.:||||||||.|||.|||.||||..||:||.|||:|:||.|.||||||.:|
Human     3 RSYNDELQFLEKINKNCWRIKKGFVPNMQVEGVFYVNDALEKLMFEELRNACRGGGVGGFLPAMK 67

  Fly    69 QIANVAALPGIVGRSIGLPDIHSGYGFAIGNMAAFDMNDPLSVVSPGGVGFDINCGVRLLRTNLY 133
            ||.|||||||||.|||||||:|||||||||||||||||||.:||||||||||||||||||||||.
Human    68 QIGNVAALPGIVHRSIGLPDVHSGYGFAIGNMAAFDMNDPEAVVSPGGVGFDINCGVRLLRTNLD 132

  Fly   134 EKDVQPVKEQLAQSLFDHIPVGVGSKGIIPMNARDLEEALEMGMDWSLREGYVWAEDKEHCEEYG 198
            |.|||||||||||::||||||||||||:|||||:|||||||||:||||||||.||||||||||||
Human   133 ESDVQPVKEQLAQAMFDHIPVGVGSKGVIPMNAKDLEEALEMGVDWSLREGYAWAEDKEHCEEYG 197

  Fly   199 RMLNADPAKVSMRAKKRGLPQLGTLGAGNHYAEIQVVDEIYDKWSASKMGIEEKGQVVVMIHSGS 263
            |||.|||.|||.||||||||||||||||||||||||||||:::::|.||||:.||||.|||||||
Human   198 RMLQADPNKVSARAKKRGLPQLGTLGAGNHYAEIQVVDEIFNEYAAKKMGIDHKGQVCVMIHSGS 262

  Fly   264 RGFGHQVATDALVQMEKAMKRDKIETNDRQLACARINSVEGQDYLKAMAAAANFAWVNRSSMTFL 328
            ||.||||||||||.||||||||||..||||||||||.|.|||||||.||||.|:|||||||||||
Human   263 RGLGHQVATDALVAMEKAMKRDKIIVNDRQLACARIASPEGQDYLKGMAAAGNYAWVNRSSMTFL 327

  Fly   329 TRQAFAKMFNTTPDDLDMHVIYDVSHNIAKVENHMVDGKERKLLVHRKGSTRAFPPHHPLIPVDY 393
            |||||||:|||||||||:||||||||||||||.|:||||||.|||||||||||||||||||.|||
Human   328 TRQAFAKVFNTTPDDLDLHVIYDVSHNIAKVEQHVVDGKERTLLVHRKGSTRAFPPHHPLIAVDY 392

  Fly   394 QLTGQPVLVGGTMGTCSYVLTGTEQGMQETFGSTCHGAGRALSRAKSRRNLDYKDVLDKLDQLGI 458
            ||||||||:||||||||||||||||||.||||:|||||||||||||||||||::||||||..:||
Human   393 QLTGQPVLIGGTMGTCSYVLTGTEQGMTETFGTTCHGAGRALSRAKSRRNLDFQDVLDKLADMGI 457

  Fly   459 AIRVASPKLVMEEAPESYKDVTDVVDTCHAAGISKKCIKMRPIAVIKG 506
            |||||||||||||||||||:|||||:|||.||||||.||:||||||||
Human   458 AIRVASPKLVMEEAPESYKNVTDVVNTCHDAGISKKAIKLRPIAVIKG 505

Known Domains:


GeneSequenceDomainRegion External IDIdentity
RtcBNP_609965.1 RtcB 67..506 CDD:224604 385/439 (88%)
RtcB 67..506 CDD:279481 385/439 (88%)
RTCBNP_055121.1 RtcB 68..505 CDD:334401 384/437 (88%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C159135738
eggNOG 1 0.900 E1_COG1690
Hieranoid 1 1.000
Homologene 1 1.000 H36344
Inparanoid 1 1.050 883 1.000 Inparanoid score I392
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D203128at33208
OrthoFinder 1 1.000 FOG0006447
OrthoInspector 1 1.000 T1074226
orthoMCL 1 0.900 OOG5_127467
Panther 1 1.100 LDO PTHR11118
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R2780
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1413.800

Return to query results.
Submit another query.