DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Alp12 and PHO8

Sequence 1:NP_001188848.1 Gene:Alp12 FlyBaseID:FBgn0032779 Length:596 Species:Drosophila melanogaster
Sequence 2:NP_010769.3 Gene:PHO8 SGDID:S000002889 Length:566 Species:Saccharomyces cerevisiae

Alignment Length:613 Identity:159/614 (26%)
Similarity:249/614 (41%) Gaps:155/614 (25%)


  Fly    46 GNDQSN-PVQHTKWFRSRLFLISVVFSALLITAMCIGFVVHYGMSGDVGDMETVSYWPVDLPKEQ 109
            |:|.|: |.:.....||::.:.:||...||:..:.:.|...:.:                     
Yeast    16 GSDSSSRPKKRRISKRSKIIVSTVVCIGLLLVLVQLAFPSSFAL--------------------- 59

  Fly   110 KEWYDQGIDELQKAVSRQFNRRRAKNVILFVGDGMGPNTVTAARILGVK------EEGLLRWEQF 168
                        ::.|     .:.||||.||.|||||.:::.||.....      ::.|...|.|
Yeast    60 ------------RSAS-----HKKKNVIFFVTDGMGPASLSMARSFNQHVNDLPIDDILTLDEHF 107

  Fly   169 PDMGLLKTYCADKQVPDSFSTATALFGGVKVNYETGGVDANVPLGNCSASLKEDHH--VQTILKW 231
              :|..:|..:|..|.||.:.|||....:|......|||              .||  ..|:|:.
Yeast   108 --IGSSRTRSSDSLVTDSAAGATAFACALKSYNGAIGVD--------------PHHRPCGTVLEA 156

  Fly   232 AQVDGMRTGFVTTTRVTHATPAALYAHVPDRRWECESGMPAEAQGQGCMDIARQLIEQPTGQSIN 296
            |::.|..||.|.|||:|.||||:..:|| |.||            |..:....||.|.|.|:.::
Yeast   157 AKLAGYLTGLVVTTRITDATPASFSSHV-DYRW------------QEDLIATHQLGEYPLGRVVD 208

  Fly   297 VIMGGGRQMLVSDVTGSAADPLDTWAGQSKDGRDLIRDWRLKKADEGVSHAVV-----QNNRELW 356
            ::|||||......  |..|.|.. ..|..|||||||        ||..|:...     :|...|.
Yeast   209 LLMGGGRSHFYPQ--GEKASPYG-HHGARKDGRDLI--------DEAQSNGWQYVGDRKNFDSLL 262

  Fly   357 NLNGQDVDY-VLGIFANGHLMYDHERDRSDAGMPSLS---NMTLKALEVLGNSDK---GFLLVVE 414
            ..:|::|.. .||:||:..:.::.:||..:  .|||.   .:.|.|||...|.||   ||.|:||
Yeast   263 KSHGENVTLPFLGLFADNDIPFEIDRDEKE--YPSLKEQVKVALGALEKASNEDKDSNGFFLMVE 325

  Fly   415 AGLIDQAHHRGNARKALSEVLELNAAVESTLSFLKSSDRLDETLVIVTADHSHSLTINGHPDRGS 479
            ...||.|.|:.:....:.|||..:.|.:..|.|.::||  .||:::.|:||.....:.......|
Yeast   326 GSRIDHAGHQNDPASQVREVLAFDEAFQYVLEFAENSD--TETVLVSTSDHETGGLVTSRQVTAS 388

  Fly   480 --------SILGLAGNSKTEGTPYTTLTYGTSYQGFQVDPQTQSRKDPTADDITAWEYTQ---QA 533
                    .:|..|.:| .|......:.:...::|.....:...:.:....|:..::||.   :.
Yeast   389 YPQYVWYPQVLANATHS-GEFLKRKLVDFVHEHKGASSKIENFIKHEILEKDLGIYDYTDSDLET 452

  Fly   534 AINTDEN---------------------LHGGS--DVTIHA----DGAMSYLFH---GVHEQSYV 568
            .|:.|:|                     .||.|  ||.|:|    ....||:.:   |.||.:  
Yeast   453 LIHLDDNANAIQDKLNDMVSFRAQIGWTTHGHSAVDVNIYAYANKKATWSYVLNNLQGNHENT-- 515

  Fly   569 AHAISYALRIGRFRDSSIAETLAELTPI 596
                    .:|:|.::.:...|.|:|.:
Yeast   516 --------EVGQFLENFLELNLNEVTDL 535

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Alp12NP_001188848.1 ALP_like 134..579 CDD:304875 142/506 (28%)
PHO8NP_010769.3 PhoA 8..530 CDD:224699 157/607 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C21965877
eggNOG 1 0.900 E1_COG1785
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 141 1.000 Inparanoid score I1162
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000248
OrthoInspector 1 1.000 T634479
orthoMCL 1 0.900 OOG5_126976
Panther 1 1.100 O PTHR11596
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R959
TreeFam 00.000 Not matched by this tool.
109.820

Return to query results.
Submit another query.