DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Alp12 and Akp3

Sequence 1:NP_001188848.1 Gene:Alp12 FlyBaseID:FBgn0032779 Length:596 Species:Drosophila melanogaster
Sequence 2:NP_073171.1 Gene:Akp3 RGDID:621650 Length:562 Species:Rattus norvegicus

Alignment Length:513 Identity:197/514 (38%)
Similarity:267/514 (52%) Gaps:52/514 (10%)


  Fly   105 LPKEQKE---WYDQGIDELQKAVSRQFNRRRAKNVILFVGDGMGPNTVTAARILGVKEEG----- 161
            :|.|::.   |..:..|.|..|...|..:..|||:|:|:|||||..||||.|||..:.||     
  Rat    21 IPVEEENPAFWNQKAADALNVAKKLQPIQTSAKNLIIFLGDGMGVPTVTATRILKGQLEGNLGPE 85

  Fly   162 -LLRWEQFPDMGLLKTYCADKQVPDSFSTATALFGGVKVNYETGGVDANVPLGNCSASLKEDHHV 225
             .|..:.||.|.|.|||..|:|||||.|||||...|||.||:|.||.|......|:.:.  .:.|
  Rat    86 TPLAMDHFPYMALSKTYSVDRQVPDSASTATAYLCGVKTNYKTIGVSAAARFDQCNTTF--GNEV 148

  Fly   226 QTILKWAQVDGMRTGFVTTTRVTHATPAALYAHVPDRRWECESGMPAEAQGQGCMDIARQLIEQP 290
            .:::..|:..|...|.||||||.||:||..|.|..:|.|..::.|||.|..:||.|||.|||   
  Rat   149 LSVMYRAKKAGKSVGVVTTTRVQHASPAGTYVHTVNRNWYGDADMPASALQEGCKDIATQLI--- 210

  Fly   291 TGQSINVIMGGGRQMLVSDVTGSAADPLD-TWAGQSKDGRDLIRDWRLKKADEGVSHAVVQNNRE 354
            :...||||:||||:.:....|.....|.| ...|...||::|:::|..|.          |.::.
  Rat   211 SNMDINVILGGGRKYMFPAGTPDPEYPNDVNETGTRLDGKNLVQEWLSKH----------QGSQY 265

  Fly   355 LWNLN-------GQDVDYVLGIFANGHLMYDHERD-RSDAGMPSLSNMTLKALEVLGNSDKGFLL 411
            :||..       ...|.|::|:|......::.:|| ..|   |||.:||..||.||..:.|||.|
  Rat   266 VWNRQELIQKSLDPSVTYLMGLFEPVDTKFEIQRDPLMD---PSLKDMTEAALHVLSRNPKGFYL 327

  Fly   412 VVEAGLIDQAHHRGNARKALSEVLELNAAVESTLSFLKSSDRLDETLVIVTADHSHSLTINGHPD 476
            .||.|.||:.||.|.|..||:|.:.|::|:|.........|    ||.||||||||..:..|:..
  Rat   328 FVEGGRIDRGHHLGTAYLALTEAVMLDSAIERASQLTSEQD----TLTIVTADHSHVFSFGGYTL 388

  Fly   477 RGSSILGLAGNSKTEGTPYTTLTYGT--SYQGFQVDPQTQSRK--DPTADDITAWEYTQQAAINT 537
            ||:||.|||..:..:|.|||::.||.  .|.|....|.....:  ||:        |.||||:..
  Rat   389 RGTSIFGLAPLNALDGKPYTSILYGNGPGYVGTGERPNVTDAESHDPS--------YQQQAAVPV 445

  Fly   538 DENLHGGSDVTIHADGAMSYLFHGVHEQSYVAHAISYALRIGRFRDSSIAETLAELTP 595
            ....|||.||.|.|.|..::|.|||.||:|:||.:::|..:..:.|..:|....|..|
  Rat   446 KSETHGGEDVAIFARGPQAHLLHGVQEQNYIAHVMAFAGCLEPYTDCGLAPPADENRP 503

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Alp12NP_001188848.1 ALP_like 134..579 CDD:304875 185/464 (40%)
Akp3NP_073171.1 Alk_phosphatase 52..486 CDD:278666 186/464 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C21898274
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D216917at33208
OrthoFinder 1 1.000 FOG0000248
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11596
Phylome 1 0.910 0.731 Consistency score
TreeFam 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.