DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Alp12 and alpi.2

Sequence 1:NP_001188848.1 Gene:Alp12 FlyBaseID:FBgn0032779 Length:596 Species:Drosophila melanogaster
Sequence 2:NP_001020359.1 Gene:alpi.2 ZFINID:ZDB-GENE-050626-142 Length:521 Species:Danio rerio

Alignment Length:504 Identity:199/505 (39%)
Similarity:281/505 (56%) Gaps:49/505 (10%)


  Fly   105 LPKEQKE---WYDQGIDELQKAVSRQFNRRRAKNVILFVGDGMGPNTVTAARIL------GVKEE 160
            :|:|:|.   ||.:..|.|..::|..||..||||:|||:|||||.:||||||:|      ...||
Zfish    25 VPEEEKNPNFWYVKAKDSLHASLSMTFNTHRAKNLILFLGDGMGISTVTAARVLKGQMNKKTGEE 89

  Fly   161 GLLRWEQFPDMGLLKTYCADKQVPDSFSTATALFGGVKVNYETGGVDANVPLGNCSASLKEDHHV 225
            .:|..:.||.:.|.|||..|:|:|||.:||||...|||.||.|.|:.|......|| |:| .:.|
Zfish    90 SVLAMDTFPYLALSKTYNVDQQMPDSAATATAYLCGVKANYGTLGLSAAAQREVCS-SVK-GNEV 152

  Fly   226 QTILKWAQVDGMRTGFVTTTRVTHATPAALYAHVPDRRWECESGMPAEAQGQGCMDIARQLIEQP 290
            ::||..|::.|...|.|:|.||.||:|||.|:|.|:|.|..:..:.:||...||.|||.|||   
Zfish   153 KSILHQAKMAGKSVGIVSTARVQHASPAASYSHTPERGWYSDKELTSEAVAGGCQDIAVQLI--- 214

  Fly   291 TGQSINVIMGGGRQMLVSDVTGSAADP-LDTWAGQSKDGRDLIRDWRLKKADEGVSHAVVQNNRE 354
            |...||||:|||||.:....|   .|| ..|..|..||.|:|:.:| ||..         :|.:.
Zfish   215 TNTDINVILGGGRQYMFPRET---TDPEYSTVTGSRKDKRNLVDEW-LKNR---------KNAQY 266

  Fly   355 LWN------LNGQDVDYVLGIFANGHLMYDHERD-RSDAGMPSLSNMTLKALEVLGNSDKGFLLV 412
            :||      :|....||::|:|......|:.||| :.|   |||:.|..||:::|..:..||.|.
Zfish   267 VWNKQQFDAVNEDKTDYLMGLFEPKDTRYELERDPKMD---PSLTEMVEKAIKILRKNPNGFYLF 328

  Fly   413 VEAGLIDQAHHRGNARKALSEVLELNAAVESTLSFLKSSDRLDETLVIVTADHSHSLTINGHPDR 477
            ||.|.||..||.|.|:.||:|.:|.:.::|.........|    ||.:|||||||..:..|:..|
Zfish   329 VEGGRIDHGHHAGQAKYALTEAVEFDNSIERAGQLTSELD----TLSVVTADHSHVFSFGGYSYR 389

  Fly   478 GSSILGLAGNSKTEGTPYTTLTYGTSYQGFQVDPQTQSRKDPTADDITAW--EYTQQAAINTDEN 540
            |:.:||::.....:|..:|...||.. .|:|:...|:    |..::..:.  :|.||||:..|..
Zfish   390 GNPVLGVSYAKGEDGKSFTNALYGNG-PGYQITNGTR----PDVNESVSGRDDYLQQAAVPLDSE 449

  Fly   541 LHGGSDVTIHADGAMSYLFHGVHEQSYVAHAISYALRIGRFRDSSIAET 589
            .||..||.|.|.|.|::|||||.||||:.||:::|..|..:.|..:.::
Zfish   450 THGSEDVAIFAKGPMAHLFHGVQEQSYIPHAMAFAACIEPYSDCQLHDS 498

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Alp12NP_001188848.1 ALP_like 134..579 CDD:304875 186/461 (40%)
alpi.2NP_001020359.1 Alk_phosphatase 56..487 CDD:278666 186/461 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C21936750
eggNOG 1 0.900 E1_COG1785
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D216917at33208
OrthoFinder 1 1.000 FOG0000248
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126976
Panther 1 1.100 O PTHR11596
Phylome 1 0.910 0.731 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.750

Return to query results.
Submit another query.