DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Alp12 and Alp1

Sequence 1:NP_001188848.1 Gene:Alp12 FlyBaseID:FBgn0032779 Length:596 Species:Drosophila melanogaster
Sequence 2:NP_001262159.1 Gene:Alp1 FlyBaseID:FBgn0283479 Length:530 Species:Drosophila melanogaster

Alignment Length:543 Identity:194/544 (36%)
Similarity:269/544 (49%) Gaps:68/544 (13%)


  Fly    70 FSALLITAMCIGFVVHYGMSGDVGDMETVSYWPVDLPKEQKE---WYDQGIDELQKAVSRQFNRR 131
            |:||.:..........||..         ..|.:|...|.|.   |:......|...:|...|:.
  Fly     7 FAALALQLTACSSQYKYGPE---------QSWDLDSISELKSKEFWFHDAQRTLYNKLSTPPNQY 62

  Fly   132 RAKNVILFVGDGMGPNTVTAARILG------VKEEGLLRWEQFPDMGLLKTYCADKQVPDSFSTA 190
            ||||||.|:||||...||||.||..      |.|...|.:|:|..:||.||||.:|||.||..||
  Fly    63 RAKNVIFFLGDGMSVPTVTAGRIFDGQLRGVVGERNRLEFEKFNYVGLSKTYCVNKQVADSACTA 127

  Fly   191 TALFGGVKVNYETGGVDANVPLGNCSASLKEDHHVQTILKWAQVDGMRTGFVTTTRVTHATPAAL 255
            :|...|:|.||.|.||.|:|.|.:|..|....:.:.:|..||.......|.|||||||||:||.:
  Fly   128 SAYLSGIKANYLTIGVTADVELNDCRGSRLPQNRLSSIAAWALKGSKSAGLVTTTRVTHASPAGV 192

  Fly   256 YAHVPDRRWECESGMPAEAQGQG-CMDIARQLIEQPTGQSINVIMGGGRQMLV----SDVTGSAA 315
            |||..:|.:|.:..:....|..| |.|||:|||:...|:.:.|:||||....:    :||.|:  
  Fly   193 YAHTSNRDFESDYDVTKLGQNPGNCPDIAQQLIDGDVGKRLRVVMGGGTIKFLPNTTNDVFGN-- 255

  Fly   316 DPLDTWAGQSKDGRDLIRDWRLKKADEGVSHAVVQNNRELWNLNGQDVDYVLGIFANGHLMYDHE 380
                  .||..|.|:||.:|:..|....   .||.:..:|.|.:.|:.|::||:|...||.| |.
  Fly   256 ------KGQRLDNRNLIEEWQQTKPGNA---RVVFSRTDLLNNDAQNTDFLLGLFNASHLAY-HM 310

  Fly   381 RDRSDAGMPSLSNMTLKALEVLGNSDKGFLLVVEAGLIDQAHHRGNARKALSEVLELNAAVESTL 445
            .|..|.  |:|..||..|:.||.....|:.|.||.|.||.|||...|:|||.|.::.:.||....
  Fly   311 DDSIDT--PTLPEMTAAAINVLSRDPNGYFLFVEGGRIDHAHHETKAKKALDETVQFSDAVRKAR 373

  Fly   446 SFLKSSDRLDETLVIVTADHSHSLTINGHPDRGSSILGLAGN-SKTEGTPYTTLTY--GTSYQGF 507
            ......|    ||::|:|||.|::||:|:||..:||:||... |..:..|||:::|  |.:|:.|
  Fly   374 QLTNPWD----TLIVVSADHGHTVTISGYPDVNNSIVGLNSELSNVDQLPYTSISYANGPAYERF 434

  Fly   508 ---------QVDPQTQSRKDPTADDITAWEYTQQAAINTDENLHGGSDVTIHA-------DGAMS 556
                     :||.:......|.|        .....:...|..|||.||.::|       .|..|
  Fly   435 YKSTDGVVERVDLRNLDFSKPDA--------IYPHGVPMTEETHGGGDVAVYAHVVEYLLQGPWS 491

  Fly   557 YLFHGVHEQSYVAHAISYALRIG 579
            :||.||:|||.:.|.:.:|..:|
  Fly   492 HLFTGVYEQSTLPHLMGFASCLG 514

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Alp12NP_001188848.1 ALP_like 134..579 CDD:304875 178/475 (37%)
Alp1NP_001262159.1 alkPPc 65..514 CDD:214515 178/475 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C21455832
eggNOG 1 0.900 E1_COG1785
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 141 1.000 Inparanoid score I1162
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D216917at33208
OrthoFinder 1 1.000 FOG0000248
orthoMCL 1 0.900 OOG5_126976
Panther 1 1.100 P PTHR11596
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R959
87.920

Return to query results.
Submit another query.