DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Alp12 and Alp8

Sequence 1:NP_001188848.1 Gene:Alp12 FlyBaseID:FBgn0032779 Length:596 Species:Drosophila melanogaster
Sequence 2:NP_001286709.1 Gene:Alp8 FlyBaseID:FBgn0034712 Length:533 Species:Drosophila melanogaster

Alignment Length:540 Identity:190/541 (35%)
Similarity:287/541 (53%) Gaps:43/541 (8%)


  Fly    62 RLFLISVVFSALLITAMCIGFVVH--YGMSGDVG-------DMETVSYWPVDLPKEQ--KEWYDQ 115
            :|.|..::..||..||:|....||  ..::|...       |:.|..|.|   |:|.  :.||:.
  Fly     7 QLVLPILLLLALAGTALCGVQEVHNVLELTGQAANKLKFSTDVATEKYTP---PEEMDPQYWYNI 68

  Fly   116 GIDELQKAVS-RQFNRRRAKNVILFVGDGMGPNTVTAARIL------GVKEEGLLRWEQFPDMGL 173
            ..:|:.|.:. .|.|.::|||:|:|:||||..:||.|||||      ...||..|.:|:||..||
  Fly    69 ADEEITKRLQLPQPNSQKAKNIIMFLGDGMPLSTVAAARILKGQRQGNTGEESSLSFERFPYTGL 133

  Fly   174 LKTYCADKQVPDSFSTATALFGGVKVNYETGGVDANVPLGNCSASLKEDHHVQTILKWAQVDGMR 238
            .:|||::.|||||..||||...|||.|....||.|.|...||:||....:.:.:|.:|||..|..
  Fly   134 SRTYCSNAQVPDSACTATAYLCGVKTNIVNIGVSAAVEYNNCTASQDPANRLTSIAEWAQNAGKS 198

  Fly   239 TGFVTTTRVTHATPAALYAHVPDRRWECESGMPA-EAQGQGCMDIARQLIEQPTGQSINVIMGGG 302
            ||.||||.:|||:|:..||...:|.|||::.:.: ......|:|:|.||:.|..|::..|:.|||
  Fly   199 TGIVTTTTLTHASPSGAYAKTANRMWECDTDVTSYGVDANSCIDMATQLVTQTPGKNFEVMFGGG 263

  Fly   303 R-QMLVSDVTGSAADPLDTWAGQSKDGRDLIRDWRLKKADEGVSHAVVQNNRELWNLNGQDVDYV 366
            . :.|.:.:..|..:|     |:..||.:|:..|: ...|.||   :|.|..:|..||...|..|
  Fly   264 MGKFLPNSIVDSHGNP-----GERSDGVNLLSRWQ-GLHDGGV---LVTNRNQLLKLNVSAVSSV 319

  Fly   367 LGIFANGHLMYDHERDRSDAGMPSLSNMTLKALEVLG-NSDKGFLLVVEAGLIDQAHHRGNARKA 430
            :|:|.:..:.:..|.|  |...|:||.:|...::.|. |.:.|:...:|.||||..:|...|..|
  Fly   320 IGLFQSKLMNFHLEAD--DTYQPTLSELTEVTIKKLSQNKEHGYFAFIEGGLIDYGNHYTKAGYA 382

  Fly   431 LSEVLELNAAVESTLSFLKSSDRLDETLVIVTADHSHSLTINGHPDRGSSILGL-AGNSKTEGTP 494
            |.|.||...|::    ..:....:::||::|||||.|:::|.|:|.||:.|||: ..::...|..
  Fly   383 LDEALEFEKAIQ----LARDMTDIEDTLIVVTADHGHAVSIAGYPGRGTPILGINQHDTDINGVQ 443

  Fly   495 YTTLTYGTSYQGFQVDPQTQSRKDPTADDITAWEYTQQAAINTDENLHGGSDVTIHADGAMSYLF 559
            |:.|.|......: :|...|  :.|..|.:.:.:....:.|..|:.:|.|.||.|.|.|..|:||
  Fly   444 YSVLNYAAGPNQY-LDENGQ--RIPLDDILGSDDAITPSYIPKDQGVHSGEDVGIFASGPQSHLF 505

  Fly   560 HGVHEQSYVAHAISYALRIG 579
            .||.:||.:.|.::||..||
  Fly   506 TGVMQQSTIPHLMAYAACIG 525

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Alp12NP_001188848.1 ALP_like 134..579 CDD:304875 166/455 (36%)
Alp8NP_001286709.1 ALP_like 88..525 CDD:304875 166/455 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C21455861
eggNOG 1 0.900 E1_COG1785
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 141 1.000 Inparanoid score I1162
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D216917at33208
OrthoFinder 1 1.000 FOG0000248
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11596
RoundUp 00.000 Not matched by this tool.
65.990

Return to query results.
Submit another query.