DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Alp12 and Akp3

Sequence 1:NP_001188848.1 Gene:Alp12 FlyBaseID:FBgn0032779 Length:596 Species:Drosophila melanogaster
Sequence 2:NP_031458.2 Gene:Akp3 MGIID:87984 Length:559 Species:Mus musculus

Alignment Length:503 Identity:197/504 (39%)
Similarity:273/504 (54%) Gaps:48/504 (10%)


  Fly   105 LPKEQKE---WYDQGIDELQKAVSRQFNRRRAKNVILFVGDGMGPNTVTAARILGVKEEG----- 161
            :|.|::.   |..:..:.|..|...|..:..|||:|:|:|||||..||||.|||..:.||     
Mouse    21 IPVEEENPAFWNKKAAEALDAAKKLQPIQTSAKNLIIFLGDGMGVPTVTATRILKGQLEGHLGPE 85

  Fly   162 -LLRWEQFPDMGLLKTYCADKQVPDSFSTATALFGGVKVNYETGGVDANVPLGNCSASLKEDHHV 225
             .|..::||.|.|.|||..|:|||||.|||||...|||.||:|.||.|......|:.:.  .:.|
Mouse    86 TPLAMDRFPYMALSKTYSVDRQVPDSASTATAYLCGVKTNYKTIGVSAAARFDQCNTTF--GNEV 148

  Fly   226 QTILKWAQVDGMRTGFVTTTRVTHATPAALYAHVPDRRWECESGMPAEAQGQGCMDIARQLIEQP 290
            .:::..|:..|...|.||||||.||:|:..|.|..:|.|..::.|||.|..:||.|||.|||   
Mouse   149 FSVMYRAKKAGKSVGVVTTTRVQHASPSGTYVHTVNRNWYGDADMPASALREGCKDIATQLI--- 210

  Fly   291 TGQSINVIMGGGRQMLVSDVTGSAADPLD-TWAGQSKDGRDLIRDWRLKKADEGVSHAVVQNNRE 354
            :...||||:||||:.:....|.....|.| ...|...|||:|:::|..|.          |.::.
Mouse   211 SNMDINVILGGGRKYMFPAGTPDPEYPNDANETGTRLDGRNLVQEWLSKH----------QGSQY 265

  Fly   355 LWN-----LNGQD--VDYVLGIFANGHLMYDHERD-RSDAGMPSLSNMTLKALEVLGNSDKGFLL 411
            :||     ...||  |.|::|:|......:|.:|| ..|   |||.:||..|::||..:.|||.|
Mouse   266 VWNREQLIQKAQDPSVTYLMGLFEPVDTKFDIQRDPLMD---PSLKDMTEAAVKVLSRNPKGFYL 327

  Fly   412 VVEAGLIDQAHHRGNARKALSEVLELNAAVESTLSFLKSSDRLDETLVIVTADHSHSLTINGHPD 476
            .||.|.||:.||.|.|..||:|.:..:.|:|.....  :|:|  :||.||||||||..:..|:..
Mouse   328 FVEGGRIDRGHHLGTAYLALTEAVMFDLAIERASQL--TSER--DTLTIVTADHSHVFSFGGYTL 388

  Fly   477 RGSSILGLAGNSKTEGTPYTTLTYGT--SYQGFQVDPQTQSRKDPTADDITAWEYTQQAAINTDE 539
            ||:||.|||..:..:|.|||::.||.  .|.|      |..|.:.||.:.:...|.||||:....
Mouse   389 RGTSIFGLAPLNALDGKPYTSILYGNGPGYVG------TGERPNVTAAESSGSSYRQQAAVPVKS 447

  Fly   540 NLHGGSDVTIHADGAMSYLFHGVHEQSYVAHAISYALRIGRFRDSSIA 587
            ..|||.||.|.|.|..::|.|||.||:|:||.:::|..:..:.|..:|
Mouse   448 ETHGGEDVAIFARGPQAHLLHGVQEQNYIAHVMAFAGCLEPYTDCGLA 495

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Alp12NP_001188848.1 ALP_like 134..579 CDD:304875 188/462 (41%)
Akp3NP_031458.2 Alk_phosphatase 52..486 CDD:278666 189/462 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C21903564
eggNOG 1 0.900 E1_COG1785
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D216917at33208
OrthoFinder 1 1.000 FOG0000248
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126976
Panther 1 1.100 O PTHR11596
Phylome 1 0.910 0.731 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.750

Return to query results.
Submit another query.