DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Alp12 and alpl

Sequence 1:NP_001188848.1 Gene:Alp12 FlyBaseID:FBgn0032779 Length:596 Species:Drosophila melanogaster
Sequence 2:XP_002943485.2 Gene:alpl XenbaseID:XB-GENE-1010301 Length:439 Species:Xenopus tropicalis

Alignment Length:413 Identity:169/414 (41%)
Similarity:235/414 (57%) Gaps:26/414 (6%)


  Fly   103 VDLPKEQKE---WYDQGIDELQKA--VSRQFNRRRAKNVILFVGDGMGPNTVTAARILGVK---- 158
            |..|:::|:   |..|..|.|:.|  :.:..|...|||||:|:|||||..||||.|||..:    
 Frog    17 VTFPEQEKDPKYWRRQAQDTLRDALLLLQNLNTNVAKNVIMFLGDGMGVPTVTATRILKGQMAGQ 81

  Fly   159 --EEGLLRWEQFPDMGLLKTYCADKQVPDSFSTATALFGGVKVNYETGGVDANVPLGNCSASLKE 221
              ||..|..::||.:.|.|||..:.|||||..||||...|||.|..|.||:|....|.|:.:  .
 Frog    82 PGEETQLEMDKFPHVALSKTYNTNAQVPDSAGTATAYLCGVKANEGTVGVNAAAVRGQCNTT--R 144

  Fly   222 DHHVQTILKWAQVDGMRTGFVTTTRVTHATPAALYAHVPDRRWECESGMPAEAQGQGCMDIARQL 286
            .:.|.:|||||:..|...|.|||||:.||||:|.|||..:|.|..:..||.||..|||.|||.||
 Frog   145 GNEVDSILKWAKQAGKSVGVVTTTRINHATPSAAYAHCVNRDWYSDLEMPKEAVEQGCKDIAWQL 209

  Fly   287 IEQPTGQSINVIMGGGRQMLVSDVTGSAADPLDTWA-GQSKDGRDLIRDWRLKKADEGVSHAVVQ 350
            :...  .:|.|||||||:.:....|.....|.|..| |...||.:|.:.|..:|.::..:. .|.
 Frog   210 MHNV--PNIEVIMGGGRKYMYPRNTSDVEYPNDDKASGTRLDGLNLTQIWLDQKPNKQAAR-YVW 271

  Fly   351 NNRELWNLNGQDVDYVLGIFANGHLMYDHERDRS-DAGMPSLSNMTLKALEVLGNSDKGFLLVVE 414
            |.::|.::|.|:||::||:|....::|:.||:.: |   |||..|...|:::|..:.:||.|:||
 Frog   272 NRQQLLSVNPQEVDHLLGLFEPIDMLYELERNTTMD---PSLPEMVEMAIKILRKNPEGFFLLVE 333

  Fly   415 AGLIDQAHHRGNARKALSEVLELNAAVESTLSFLKSSDRLDETLVIVTADHSHSLTINGHPDRGS 479
            .|.||..||.|.|.:||.|.::::.|:....|.....|    ||.:|||||||..|..|:..||:
 Frog   334 GGRIDHGHHEGKANQALHEAVQMDIAIGLAGSMTSEED----TLTVVTADHSHVFTFGGYTHRGT 394

  Fly   480 SILGLA-GNSKTEGTPYTTLTYG 501
            ||.||| ..|..:..|:|::.||
 Frog   395 SIFGLAPAVSDVDQKPFTSILYG 417

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Alp12NP_001188848.1 ALP_like 134..579 CDD:304875 159/378 (42%)
alplXP_002943485.2 Alk_phosphatase 52..436 CDD:278666 160/379 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C21951357
eggNOG 1 0.900 E1_COG1785
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D216917at33208
OrthoFinder 1 1.000 FOG0000248
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.