DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Alp12 and alpi.2

Sequence 1:NP_001188848.1 Gene:Alp12 FlyBaseID:FBgn0032779 Length:596 Species:Drosophila melanogaster
Sequence 2:NP_001116946.1 Gene:alpi.2 XenbaseID:XB-GENE-854953 Length:532 Species:Xenopus tropicalis

Alignment Length:526 Identity:204/527 (39%)
Similarity:278/527 (53%) Gaps:65/527 (12%)


  Fly    71 SALLITAMCIGFVVHYGMSGDVGDMETVSYWPVDLPKEQKEWYDQGIDELQKAVSRQFNRRRAKN 135
            :|||:.|:    .||......|..:|.        .|..|.|.||..:.|:.|::......||||
 Frog    16 TALLLLAI----TVHPSTGVVVSSLEA--------EKNPKFWNDQAKETLKNALNLNPITHRAKN 68

  Fly   136 VILFVGDGMGPNTVTAARILGVK------EEGLLRWEQFPDMGLLKTYCADKQVPDSFSTATALF 194
            :|:|:|||||..|:.||||...:      ||.::..|:||.:.|.|.|..|.|||||..|.||..
 Frog    69 LIMFLGDGMGVTTIAAARIYQGQVEGQPGEENIMAMEKFPYVALSKVYNVDAQVPDSAGTGTAYL 133

  Fly   195 GGVKVNYETGGVDANVPLGNCSASLKEDHHVQTILKWAQVDGMRTGFVTTTRVTHATPAALYAHV 259
            .|||.|..|.||.|....|||.:|  :.:.|.:||..|::.|...|.||||||.||:|.|.|||.
 Frog   134 CGVKANSGTLGVSAAAIYGNCVSS--KGNEVTSILHRAKLAGKSVGIVTTTRVQHASPGAAYAHS 196

  Fly   260 PDRRWECESGMPAEAQGQGCMDIARQLIEQPTGQSINVIMGGGRQMLV------SDVTGSAADPL 318
            ..|.|..::.|.:.....||.|||.||:.   ...|:||:||||..:.      .:..||:||  
 Frog   197 ASRNWYSDNEMTSAMINNGCKDIAYQLVH---NTDIDVILGGGRAYMYPAGTPDPEYPGSSAD-- 256

  Fly   319 DTWAGQSKDGRDLIRDWRLKKADEGVSHAVVQNNRELWN------LNGQDVDYVLGIFANGHLMY 377
               .|..:||.:|...|..|:          ||.|.:||      :|....||::|:|....:.|
 Frog   257 ---RGLRRDGLNLTDIWLSKR----------QNARYVWNKEQFNAVNVDTTDYLMGLFEPKDMKY 308

  Fly   378 DHERDRS-DAGMPSLSNMTLKALEVLGNSDKGFLLVVEAGLIDQAHHRGNARKALSEVLELNAAV 441
            :..|:.| |   |||:.||.||:.:|..:.|||.|.||.|.||..||.|||:::|:|.||.:.||
 Frog   309 ELNRNASLD---PSLAEMTEKAIRILSKNPKGFFLFVEGGRIDHGHHDGNAKQSLTEALEFDKAV 370

  Fly   442 ESTLSFLKSSD--RLDETLVIVTADHSHSLTINGHPDRGSSILGLAGNSKTEGTPYTTLTYGTSY 504
                  |:...  :.:|||.:|||||||..|..|:.|||:||.|||.:..::..|||:|.||.. 
 Frog   371 ------LRGGQLTQENETLTVVTADHSHVFTFGGYTDRGNSIFGLAPSLASDRKPYTSLLYGNG- 428

  Fly   505 QGFQVDPQTQSRKDPTADDITAWEYTQQAAINTDENLHGGSDVTIHADGAMSYLFHGVHEQSYVA 569
            .|:.:....  |.:.|..:..:..|.||||:......|||.||.|.|.|..::||||.|||||:|
 Frog   429 PGYPLPDAI--RANITGVNTGSNSYLQQAAVPVVSETHGGEDVAIMAKGPQAHLFHGFHEQSYIA 491

  Fly   570 HAISYA 575
            |.::||
 Frog   492 HVMAYA 497

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Alp12NP_001188848.1 ALP_like 134..579 CDD:304875 187/464 (40%)
alpi.2NP_001116946.1 Alk_phosphatase 66..500 CDD:278666 188/465 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D216917at33208
OrthoFinder 1 1.000 FOG0000248
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.