DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31797 and Rrbp1

DIOPT Version :9

Sequence 1:NP_724173.1 Gene:CG31797 / 35203 FlyBaseID:FBgn0051797 Length:868 Species:Drosophila melanogaster
Sequence 2:NP_077243.2 Gene:Rrbp1 / 81910 MGIID:1932395 Length:1464 Species:Mus musculus


Alignment Length:538 Identity:114/538 - (21%)
Similarity:205/538 - (38%) Gaps:116/538 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   312 KRSHGKDNQG----GGDSQIPKGPSRPTKSSGDPGNPIGHGNREPGEEDKVTIVRDDGNGDRGD- 371
            |:..|..|||    |..:|..||.....::....|.. ..|.:..|.:::    ...|.|.:.. 
Mouse   279 KKGEGAQNQGKKGEGAQNQAKKGEGAQNQAKKGEGAQ-NQGKKGEGAQNQ----SKKGEGAQNQA 338

  Fly   372 KENDKDKNQFVNKDKPRVSIKENDNDGDQNNDKNKDKVVN---------FNQEENKYKNQDRYKN 427
            |:.:..:||....:..:...|:  .:|.||..|..:.|.|         .||.:....||::.|.
Mouse   339 KKGEGGQNQAKKGEGAQNQAKK--GEGAQNQAKKGEGVQNQAKKGVEGAQNQGKKGEANQNQAKK 401

  Fly   428 KEDKEKEREKKKREKAKEKKKGKDKETEKKREKVK---KKKEKNKETGKGKEKARERDKENYKGI 489
            .|..:.:.:|.:..:.:.||....::.:||.|..:   ||.|.....||..|.|:.:.|:. :|.
Mouse   402 GEGGQNQTKKGEGPQNQGKKGEAAQKQDKKIEGAQNQGKKPEGTSNQGKKGEGAQNQGKKG-EGA 465

  Fly   490 ERPREKEEGERKEREKEEEENEIENENNKEKELGKEQE--IEKFKERERPHEKDKPMEREQEREE 552
            :...:|.||.:.:.:|.|.......:....:..||:.|  ..:.|:.|....:.|..|..|.:.:
Mouse   466 QNQGKKGEGAQNQGKKGEGAQNQGKKGEGAQNQGKKGEGAQNQGKKGEGAQNQGKKGEGPQNQAK 530

  Fly   553 KGK--QEEKERERGIEKEREKGKGKEKEVNK----EHETGKQKEDKNRGK--DQFPEKGKEKKQQ 609
            ||:  |.:.::..|.:.:.:||:|.:.:..|    :.::.|.:..:|:||  |..|.:|  ||.:
Mouse   531 KGEGAQNQGKKGEGAQNQGKKGEGAQNQGKKAEGVQSQSKKGEGTQNQGKKGDGNPNQG--KKGE 593

  Fly   610 KHKEKYKDEDKIKDMDLEYEKYDRDDIKIPNN-KKNKNKSNEDSKIE----ENKPNSNLPEVTSR 669
            ....:.:..|.:.:...:.|       .:.|. ||::...|:..|.|    :.|.....|....:
Mouse   594 GASNQNRKTDTVANQGTKQE-------GVSNQVKKSEGSPNQGKKAEGAPNQGKKKDGSPSQAKK 651

  Fly   670 FFDIPVDMEFDKTIKRGTRVEDYEFPA----LEIVRDEPAAPTCKLKDPPKKKKMKRIKKVCKDK 730
                     .|....:|.:.|  ..||    ..:|:.:.|..    :|.|.|||....||     
Mouse   652 ---------VDAAANQGKKSE--MAPAQGQKASMVQSQEAPK----QDAPAKKKSGSRKK----- 696

  Fly   731 PKKVCPPCPPAGCQCEICHFM----------DRPFNEQEAPFMREM------------------- 766
                ..|.||   .|:...|:          ...|:|.||..:.|:                   
Mouse   697 ----GEPGPP---DCDGPLFLPYKTLVSTVGSMVFSEGEAQRLIEILSEKTGVIQDTWHKATQKG 754

  Fly   767 -------RRVEQKRQLRA 777
                   |::|:|.:|.|
Mouse   755 DPVAILKRQLEEKEKLLA 772

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31797NP_724173.1 None
Rrbp1NP_077243.2 Rib_recp_KP_reg 33..171 CDD:282899
Tropomyosin 833..1081 CDD:278679
SPEC 877..1071 CDD:295325
PRK02224 968..>1448 CDD:179385
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28NEJ
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.