DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31797 and rrbp1

DIOPT Version :8

Sequence 1:NP_724173.1 Gene:CG31797 / 35203 FlyBaseID:FBgn0051797 Length:868 Species:Drosophila melanogaster
Sequence 2:XP_017949321.1 Gene:rrbp1 / 448168 XenbaseID:XB-GENE-5800192 Length:1085 Species:Xenopus tropicalis

Alignment Length:1047 Identity:195/1048 (19%)
Similarity:360/1048 (34%) Gaps:315/1048 (30%)


  Fly     4 KALQRRRSAGRENDPPQLGRHDRQDNRSQRAETYPSIRKGKPHCDPNKNEATTRLANTLEADGSG 68
            :||.::|....:|.|    :.|:     ::.|..| ::|||.   ..|:|...  ....|.:.:.
 Frog    40 EALAKQRKETEKNQP----KVDK-----KKKEKLP-VQKGKA---KKKDEKPN--GKIPEHESNQ 89

  Fly    69 RPYDMVKDDVLLAWQQSPHKDTLGFYGVGSPTHQPESVVFNQVVAACLVKVNGGGTQRRIPKQDK 133
            .|.|..|       .:|.|:..|....|......|..|....|||. :.|.:..|:.:..|..:|
 Frog    90 EPTDPKK-------AESGHELILEKTPVPVVPVVPVEVPIVPVVAP-VPKKSAPGSVKSAPVSEK 146

  Fly   134 ------KPSPRDTLAQKNRTPQICKPFVLNRHALQSDLQQIPHVQQQLDPRQAFGTLYCTDHNQV 192
                  ||:|   ::|| ..|...||..:::.......:..| |.|:..|               
 Frog   147 PAPVSQKPAP---VSQK-PAPVSQKPAPVSQKPAPVSQKPAP-VSQKPAP--------------- 191

  Fly   193 PHDSTRVARQMYTGISRHQVSNIEPARKKDPRGLRHPQWYCP-PDGLEPRHGCTQYEWAKRKLDP 256
                   ..|....:|:...    |..:|.....:.|   .| |:...|         |..|  |
 Frog   192 -------VSQKPAPVSQKPA----PVSQKPAPVSQKP---APVPEKPAP---------ASEK--P 231

  Fly   257 NPNNNEFRHCPQGKDEHKSPEPLNYDQLYSRIIKCFEPKPSP----------------------- 298
            .|...  :..|..||:.|.||        .:::| .||.|||                       
 Frog   232 APVQE--KSAPSPKDKKKKPE--------KKVLK-VEPSPSPAVTFTQAVSSKHVPVLDAPIKEV 285

  Fly   299 -----DPL-CEPYEKCCKPKRSHGKDNQGGGDSQ-IPKGPSRPTK-------------------- 336
                 .|: .:|......||::....||.....: :||..|.|.|                    
 Frog   286 PVVAVSPVGSQPASSTQPPKKAEAIVNQEDSKQENVPKKKSAPKKKTEPSAEECEGAVYIPYKTL 350

  Fly   337 ---------SSGD------------------------PGNPIGHGNREPGEEDKVTIVRDDGNGD 368
                     |.|:                        .|:|:....|...|::|:.:.:.     
 Frog   351 VPTIQSMCFSKGEAQKLIEILAEKYGIMQDTWQTATQKGDPVAALKRVVEEKEKLLLAQH----- 410

  Fly   369 RGDKEND-KDKNQFVNKDKPRVSIKENDNDGDQNNDKNKDKVVNFNQEEN--KYKNQDRYKNKED 430
              :|.|. |:|...|||:     ::...:.......|.|:::|...||.|  :.:.|..|::..:
 Frog   411 --EKTNSYKEKFMEVNKE-----LQSEKSRAKTEQTKFKEQLVTREQEINALQARMQASYQDHVN 468

  Fly   431 KEKEREKKKREKAKEKKKG---------------KD------KETEKKR--EKVKKKKEKNKETG 472
            :.::.:.|.|...:|.:.|               :|      .:||.|:  |..|.::|.:|.:.
 Frog   469 ETQQLQTKVRSLQEEIENGPKAQLTRLQQENSILRDALNQATSQTESKQNAELAKLRQECSKLSK 533

  Fly   473 KGKEKA-----RERDKENYKGIERPREK---------EEGERKEREKEEEENEIENENNKEKELG 523
            :..:|:     .|:.:::..|.....||         :|||...:::.:|.||         ||.
 Frog   534 ELSDKSESLQQEEQRRKSLDGKVVTYEKQITQLQTLQQEGETTLQKRLDEVNE---------ELR 589

  Fly   524 KEQ--------EIEKFKERERPHEKDKPMEREQEREEKGKQEE----KERERGIEKEREKGKGKE 576
            |.|        :.||.|..::.|...:...:..|.|.|.|.||    .::.:|:..|..:...:.
 Frog   590 KSQSTYQNLLADTEKAKAEQKNHADLQTKLQSYEAESKQKSEELDKLNKQLQGVSGENSQLMERI 654

  Fly   577 KEVNKEHETGKQKE-DKNRGKDQFPEKGKEKKQQKHKEK-------YKDEDKIKDMDLEYEKYDR 633
            |.:....|.|:.|: ||.:.:.:..|....:.|.:.:||       .|:..::|:. :|.:|...
 Frog   655 KSIEALLEAGQNKDTDKEKQQQEVREAETAQLQIRLQEKDSHIASLEKETSELKEA-VEQQKNKN 718

  Fly   634 DDIKIPN----------NKKNKNKSNEDSKIEE------------NKPNSNL--PEVTSRFFDIP 674
            :|::..|          .|.::.|.|.:.|.:|            .|....|  |::|     |.
 Frog   719 NDLREKNWQAMEALGLSEKTSEEKLNSEKKAKEEMVQQLNAVQIQTKETLQLLYPQIT-----IE 778

  Fly   675 VDMEFDKTIKRGTRVEDYEFPALEIVRDEPAAPTCKLKDPPKKKKMKRIKKVCKDKPKKVCPPCP 739
            ....:.:.::. .|....||                |..|.:|.......|..:.|.|:......
 Frog   779 PQQSYSEWLQE-FRQRTTEF----------------LNQPTEKDGSSVSMKESQLKLKEAEDTQS 826

  Fly   740 PAGCQCEICHFMDRPFNEQEAPFMREMRRVEQKRQ------------LRAYYRQMRHQEYIRDRC 792
            ....:||....:   ..|.||......:.||::.|            |...:.|::..|...::.
 Frog   827 ALQTECEQYRTI---LGETEAMLKALQKSVEEEEQVWKAKLAASEEDLTKSHSQVKTLEETVEKL 888

  Fly   793 KTEYRAPRHQCDPIYCSNFLCQNPRLAEHCDC---LGAVQELQNLLSGSKDNEDHSRLLLRVENL 854
            :::.::.....:.|.......:....|:..:|   ...::.||.|||.|:::.:.::...|.:::
 Frog   889 RSDLQSTEQLKECISLMEAQLETQMNAKSTECQTYSNEIESLQQLLSESQEHLNATKAEARKQSV 953

  Fly   855 RKRVCQR 861
            ...|.::
 Frog   954 ELSVLRQ 960



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_28NEJ
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.