DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31797 and KTN1

DIOPT Version :8

Sequence 1:NP_724173.1 Gene:CG31797 / 35203 FlyBaseID:FBgn0051797 Length:868 Species:Drosophila melanogaster
Sequence 2:NP_001072989.1 Gene:KTN1 / 3895 HGNCID:6467 Length:1357 Species:Homo sapiens

Alignment Length:995 Identity:175/996 (18%)
Similarity:335/996 (34%) Gaps:326/996 (33%)


  Fly    30 RSQRAETYPSIRKGKPHCDPNKN-EATTRLANTLEADGSGRPYDMVKDDVLLAWQQSPHKDTLGF 93
            :.:|.:.....:..|...:..|| :...:..|..|:|....|.|....|.|              
Human    40 KQKREQKLIPTKTDKKKAEKKKNKKKEIQNGNLHESDSESVPRDFKLSDAL-------------- 90

  Fly    94 YGVGSPTHQPESVVFNQVVAACLVKVNGGGTQRRIPKQDKKPSPRDTLAQKNRTPQICKPFVLNR 158
                       :|..:||....|..|....:.|...|::||..|                 ||..
Human    91 -----------AVEDDQVAPVPLNVVETSSSVRERKKKEKKQKP-----------------VLEE 127

  Fly   159 HAL-QSDLQQIPHVQQQLDPRQAFGTLYCTDHNQVPHDSTRVARQMYTGISRHQVSNIEPARKKD 222
            ..: :||..:||  .::::|              ||     |.:|. |..|....|..:|.:||.
Human   128 QVIKESDASKIP--GKKVEP--------------VP-----VTKQP-TPPSEAAASKKKPGQKKS 170

  Fly   223 PRGL----RHPQWYCPPDGLE---PRHGCTQYEWAKRKLDPNPNNNEFRHCPQGKDEHKSPEPLN 280
            ..|.    :..:....|...:   |.|..|:.|....|...:...       |..:.....|||.
Human   171 KNGSDDQDKKVETLMVPSKRQEALPLHQETKQESGSGKKKASSKK-------QKTENVFVDEPLI 228

  Fly   281 YDQLYSRIIKCFEPKPSPDPLCEPYEKCCKPKRSHGKDNQGGGDSQIPKGPSRPTKSSGDPGNPI 345
            :...|..::...:..|..|.  .......||.:..|          |.|..::..|:..|     
Human   229 HATTYIPLMDNADSSPVVDK--REVIDLLKPDQVEG----------IQKSGTKKLKTETD----- 276

  Fly   346 GHGNREPGE----------------EDKVTIVRD---DGNGDRGD--KENDKDK-----NQFVNK 384
                :|..|                ||:...|.|   :.:|...|  |::.|.:     :|...|
Human   277 ----KENAEVKFKDFLLSLKTMMFSEDEALCVVDLLKEKSGVIQDALKKSSKGELTTLIHQLQEK 337

  Fly   385 DKPRVSIKEND---------------NDGDQNN---DKNKDKVVNFNQEENKYKNQDRYKNKEDK 431
            ||...::||:.               .:.:::|   .:.||::....:|.|.::|:.....:|.:
Human   338 DKLLAAVKEDAAATKDRCKQLTQEMMTEKERSNVVITRMKDRIGTLEKEHNVFQNKIHVSYQETQ 402

  Fly   432 EKE------REKKKREKAKEKKKG-----------------KDKETEKKREK-VKKKKEKNKETG 472
            :.:      ||:.:.|.|..|::.                 :..|..|.|:. .:...|..::||
Human   403 QMQMKFQQVREQMEAEIAHLKQENGILRDAVSNTTNQLESKQSAELNKLRQDYARLVNELTEKTG 467

  Fly   473 KGKEKARERDKENYKGIERPREKEEGERKERE------KEEEENEIENENNKEKELGKEQEIEKF 531
            |.:::..::........:...:.:|.||:..|      |...|:|...::.:.|.:.||.|::..
Human   468 KLQQEEVQKKNAEQAATQLKVQLQEAERRWEEVQSYIRKRTAEHEAAQQDLQSKFVAKENEVQSL 532

  Fly   532 KERERPHEK--DKPMEREQ---------EREEKGKQEEKERERGIEKEREKGKGKEKEVNKEH-- 583
                  |.|  |..:.::|         |.|:|...:|:..:..::...|:.:..:.::.:.|  
Human   533 ------HSKLTDTLVSKQQLEQRLMQLMESEQKRVNKEESLQMQVQDILEQNEALKAQIQQFHSQ 591

  Fly   584 ---ETG-------------------KQKEDKNRG-KDQFPEKGKEKK------------------ 607
               :|.                   ||.||.... :|:...|.:|.|                  
Human   592 IAAQTSASVLAEELHKVIAEKDKQIKQTEDSLASERDRLTSKEEELKDIQNMNFLLKAEVQKLQA 656

  Fly   608 ------------QQKHKEKYKDEDKIK--DMDLEYEKYDR-DDIKIPNNKKNKNKSNEDSKIE-- 655
                        ::..:..|..:|||:  :..|::|..:: ::.||.|: :||...:|..|::  
Human   657 LANEQAAAAHELEKMQQSVYVKDDKIRLLEEQLQHEISNKMEEFKILND-QNKALKSEVQKLQTL 720

  Fly   656 -ENKPNSNLPEVTSRFFDIPVDMEFDKTIKR------------GTRVEDYEFPALEIVRDEPAAP 707
             ..:||.::.|...:..     .|.|:.:|.            .|:.|:     |..:|.|.::.
Human   721 VSEQPNKDVVEQMEKCI-----QEKDEKLKTVEELLETGLIQVATKEEE-----LNAIRTENSSL 775

  Fly   708 TCKLKDPPKKKK--------MKRIKKVCKDKPKKVCPPCPPAGCQCEICHFMDRPFNEQEAPFMR 764
            |.:::|...|:.        ::.:|||..:|..|:                              
Human   776 TKEVQDLKAKQNDQVSFASLVEELKKVIHEKDGKI------------------------------ 810

  Fly   765 EMRRVEQKRQLRAYYRQMRHQEYIRDRCKTEYRAPRHQCDPIYCSNFLCQNPRLAEHCDCLGAVQ 829
              :.||:  .|.|...::.::|......|.|.:|.:.:...:....        |:.......||
Human   811 --KSVEE--LLEAELLKVANKEKTVQDLKQEIKALKEEIGNVQLEK--------AQQLSITSKVQ 863

  Fly   830 ELQNLLSGSKDNEDHSRLLL 849
            ||||||.|.::..:..:.:|
Human   864 ELQNLLKGKEEQMNTMKAVL 883

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31797NP_724173.1 None
KTN1NP_001072989.1 DUF3584 <319..991 CDD:288943 108/625 (17%)
Smc 667..>1352 CDD:224117 51/271 (19%)
MCP_signal 1013..1202 CDD:304920
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_28NEJ
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.