DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31797 and ktn1

DIOPT Version :8

Sequence 1:NP_724173.1 Gene:CG31797 / 35203 FlyBaseID:FBgn0051797 Length:868 Species:Drosophila melanogaster
Sequence 2:NP_001296258.1 Gene:ktn1 / 368207 ZFINID:ZDB-GENE-030408-4 Length:1262 Species:Danio rerio

Alignment Length:872 Identity:164/873 (19%)
Similarity:298/873 (34%) Gaps:263/873 (30%)


  Fly   124 TQRRIPKQDK--KPSPRDTLAQKNRTPQICKPFVLNRHALQSDLQQIPHVQQQLDP--------- 177
            |::..|.:.|  .|:|.:|.::|....|..:   ...||.:......|.|.::.:|         
Zfish   185 TKQSSPPKPKASPPAPSETTSKKKAKKQKSE---AEEHAPEVKPDPSPPVVKKEEPVITEVKTQD 246

  Fly   178 ----------------------RQAFGTLYCTDHNQVPHDSTRVARQMYTGISRHQVSNIEPARK 220
                                  :|........|...|...:..:           |:.:..|...
Zfish   247 GAAPVSTAAPPTASSSSGRRKKKQKVEAAVTVDEAHVQSSALVI-----------QIGSAAPTNH 300

  Fly   221 KDPRGLRHPQWYCPPDGLEPRHGCTQYEWAKRKLDPNPNNNEFRHCPQGKD-------------- 271
            ::.:....|    ||.....:||      .|:|.:.|..|:|.:.    |:              
Zfish   301 QNNQNNDTP----PPVPAPAKHG------KKQKSETNKENSEVKL----KELLASIGGLVLSDSD 351

  Fly   272 --------EHKSPEPLNYDQLYSRIIKCFEPKP----SPDPLCEPYEKCCKPKRSHGKDNQGGGD 324
                    ..|||..|  |..|....| |||.|    ..|.|....::  :...:.||..|...:
Zfish   352 VVSLVSLLREKSPNAL--DNWYKSTAK-FEPTPQQLAEKDRLLNTLQE--EASIAKGKVKQLSQE 411

  Fly   325 SQIPKGPSRPTKSSGDPGNPIGHGNREPGEEDKVTIVRDDGNGDRGDKENDKDKNQFVNKDKPRV 389
            .|..|..:...:|       :.|.:|         :.|            |||..|...:....:
Zfish   412 LQAEKQKTGRVES-------VLHEHR---------VAR------------DKDIMQAKAQSYQEM 448

  Fly   390 SIK----ENDNDG-----DQNNDKNKDKVVNFNQEENKYKNQDRYKNKEDKEKEREKKK---REK 442
            .||    ....||     .|.|...:|.|     |.....||...|...:..|.|.:..   :|.
Zfish   449 QIKFQQIREQLDGQIARLQQENGILRDAV-----ERCSTTNQMETKQSSELNKLRSEYNSLMKEL 508

  Fly   443 AKEKKKGKDKETEKKREKVKKKKEKNKETGKGKEKARER--DKENY-KGIERPREKEEGERK--- 501
            |:.|.|.:.:|.::|..:|..|:..::     .|.|:.|  |.:|| ..:...|||.:.|.:   
Zfish   509 AETKNKLQQEELQRKGLEVNYKQNVSQ-----LEDAKHRWEDLQNYLHSVNAEREKIQSELQNQI 568

  Fly   502 ---EREKEEEENEIENENNKEKE--LGKEQEIEKFKERERP-----HEKDKPMEREQEREEKGK- 555
               |.|...:..||::.::..|:  :.|:||.:|..:.|:.     ....:.|:.:.:.:||.: 
Zfish   569 MVAESEMASKNKEIQSLHSSLKDTLMFKDQEQQKVLQLEQQVRQLLEASQRSMQPDDQLQEKVQD 633

  Fly   556 --QEEKERERGI-------------------------EKEREKGKGKEKEVNKEHETGKQKEDKN 593
              .|.|..:..|                         |||.:: |..|..:|.|..:|..:|   
Zfish   634 LLNENKTLKVQIDNLQTQLNTQATTVSHFEELQKLLAEKELQR-KSLEDSLNAERSSGASRE--- 694

  Fly   594 RGKDQFPEKGKEKKQQKHKEKYKDEDKIKDMDLEY-EKYDRDDIKIPNNKKNKNKSNEDSKIEEN 657
                       ...|..|.|.:..:.:::::..:. ||.    :.:...:::..|.:|.::..||
Zfish   695 -----------TNMQAMHNENHTLKAELQNLQAQISEKV----VSVDQLQQSLQKRDEKTRTVEN 744

  Fly   658 KPNSNLPEVTSRFFDIPVDMEFDKTIKRGTRVEDYEFPALEIVRDEPAAPTCKLKDPPKKKKMKR 722
            ...::|.:|.::..::.|.....:.:|:  ::|..:....|....|.|....:||...|.:::|.
Zfish   745 LLETSLIQVANKEDELKVVRNECEGLKQ--QLEAVQKQTTEQTVSEKALEELQLKIQEKDEQIKS 807

  Fly   723 I--------------KKVCKDKPKKVCPPCPPAGCQCEICHFMDRPFNEQEAPFMREM------R 767
            :              |||.:|..::|      .....|:.|...:..|...:..::|:      :
Zfish   808 VEGSLQLAVNKESERKKVVEDLQQQV------EVLTAELAHLKTQESNSDLSAKLQELHAQLTAK 866

  Fly   768 RVEQKRQLRAYYRQMRHQEYIRDRCKTEYRAPRHQCDPIYCSNFLCQNPRLAEHCDCLGAVQ-EL 831
            ..:.:|..|...::|:.::      :|...||..:.           ...|||....|..|| ||
Zfish   867 DQDVERLQRELEKEMQPKQ------QTVSAAPSQEL-----------LTALAEKDKRLSDVQEEL 914

  Fly   832 QNL-----LSGSKDNEDHSRLLLRVEN 853
            ..|     |...|:||      ||.:|
Zfish   915 LELRESVELHRKKNNE------LREKN 935

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31797NP_724173.1 None
ktn1NP_001296258.1 Cast 462..1193 CDD:287183 105/535 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_28NEJ
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.