DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31797 and Ktn1

DIOPT Version :8

Sequence 1:NP_724173.1 Gene:CG31797 / 35203 FlyBaseID:FBgn0051797 Length:868 Species:Drosophila melanogaster
Sequence 2:XP_006221968.1 Gene:Ktn1 / 361029 RGDID:1308719 Length:1325 Species:Rattus norvegicus

Alignment Length:1018 Identity:181/1019 (18%)
Similarity:341/1019 (33%) Gaps:343/1019 (34%)


  Fly    30 RSQRAETYPSIRKGKPHCDPNKNEATTRLANTL-EADGSGRPYDMVKDDVLLAWQQSPHKDTLGF 93
            :.:|.:...|.:..|...:..||:.......|| |:|....|.|....|.      ||.:|    
  Rat    40 KQKREQKLISTKADKKKAEKKKNKKKEIQNGTLHESDSEHVPQDFKLSDA------SPVED---- 94

  Fly    94 YGVGSPTHQPESVVFNQVVAACLVKVNGGGTQRRIPKQDKKPSPRDTLAQKNRTPQICKPFVLNR 158
                           .|.|.|.|.......:.|...|::||..|.                 |..
  Rat    95 ---------------EQFVPAPLSVAETSSSVRERKKKEKKQKPS-----------------LEE 127

  Fly   159 HAL-QSDLQQIPH--------VQQQLDPRQAF--------------------------------- 181
            |.: :||..:||.        .:|...|.:|.                                 
  Rat   128 HIIKESDASKIPGKKVEPVLVTEQPAPPPEAAALKKKAGQKKSKNGSDELDKKVEMVMAPSQKQD 192

  Fly   182 GTLYCTDHNQVPHDSTRVARQMYTGISRHQ----------------------VSNIEPARKKDPR 224
            |:|:   |.:...:.....::   |:|:.|                      |.|.:.:...|.|
  Rat   193 GSLF---HQETKQEGGPGKKK---GLSKKQKTENVAVLVDEPLTHATASVPSVDNADSSLMTDKR 251

  Fly   225 GLRHPQWYCPPDGLEPRHGCTQYEWAKRKLDPNPNNNEFRHCPQGKDEHKSPEPLNYDQLYSRII 289
            |:..   ...||.:|   |..:....|.|:|.:..|.|.:.    |:...|.:.:.:.:      
  Rat   252 GVTD---MIKPDQVE---GIQKSGTKKLKIDTDKENAEVKF----KNFLLSLKTMMFSE------ 300

  Fly   290 KCFEPKPSPDPLCEP---YEKCCKPKRSHGKDNQGGGDSQIPKGPSRPTKSSGDPGNPIGHGNRE 351
                    .:.||..   .||....|.:..|.|:|              :.||     :.|..:|
  Rat   301 --------DEALCVVDLLKEKSGVIKEALKKSNKG--------------ELSG-----LLHQLQE 338

  Fly   352 PGEEDKVTIVRDDGNGDRGDKENDKDKNQFVNKDKPRVSIKENDNDGDQNNDKNKDKVVNFNQEE 416
              :|..:|..::|.   ...||..|...|.:..:|.|.|:.         ..:.|:::....:|.
  Rat   339 --KERLLTATKEDA---AATKERCKQLTQEMMTEKERSSVV---------MARMKERIGTLEKEH 389

  Fly   417 NKYKNQDRYKNKEDK------EKEREKKKREKAKEKKKG-----------KDKETEKKREKVKKK 464
            |.::|:.....:|.:      |:.||:.:.|.|..|::.           ...|:::..|..|.:
  Rat   390 NIFQNKMHVSYQETQQMQMKFEQVREQMEAEIAHLKQENGILRDAVSNTTNQLESKQSAELNKLR 454

  Fly   465 K-------EKNKETGKGKEKARERDKENYKGIERPREKEEGERKERE------KEEEENEIENEN 516
            :       |.|::|||.:::..::........:...:.:|.||:..|      |...|:|...::
  Rat   455 QDCGRLVSELNEKTGKLQQEGVQKKNAEQAAAQLKVQLQEAERRWEEVQSYIRKRTAEHEAAQQD 519

  Fly   517 NKEKELGKEQEIEKFKERERPHEK--DKPMEREQ---------EREEKGKQEEKERERGIEKERE 570
            .:.|.:.||.|::..      |.|  |..:.::|         |.|:|...:|:..:..::...|
  Rat   520 LQSKFVAKENEVQSL------HSKLTDTLVSKQQLEQRLMQLMESEQKRASQEESMQIQVQDILE 578

  Fly   571 KGKG-------------------------------KEKEV---------NKEHETGKQKEDKN-- 593
            :.:.                               |:|::         .::|...|::|.|:  
  Rat   579 QNEALKAQIQQFHSQIAAQTSASVLAEELHKVIAEKDKQLKQTEDSLASEQDHLASKEQELKDVQ 643

  Fly   594 ---------------RGKDQFPEKGKEKKQQKHKEKYKDEDKIKDMDLEYEKYDR-DDIKIPNNK 642
                           ..|:|.....:.:|.||......|:.::.:..|:.|...| :::||.|: 
  Rat   644 NVNFLLKAEVQKLQALAKEQAAAAHEVEKMQKSVHVKDDKIRLLEEQLQREVASRVEELKILND- 707

  Fly   643 KNKNKSNEDSKIE---ENKPNSNLPEVTSRFFDIPVDMEFDKTIKR------------GTRVEDY 692
            :||....|..|::   ..:||.::.|...:..     .|.|:.::.            .||.|: 
  Rat   708 QNKALQLEVQKLQAVVSEQPNKDVVEQMKKCI-----QEKDEKLRTVEELLETGLIQVATREEE- 766

  Fly   693 EFPALEIVRDEPAAPTCKLKDPPKKKKMKRIKKVCKDKPKKVCPPCPPAGCQCEICHFMDRPFNE 757
                |..:|.|.::.|.:::: .|.|:|.::..|...:..|            ::.|..|.....
  Rat   767 ----LNAIRTENSSLTKEVQE-LKAKQMDQVPFVSLIEDLK------------KVIHEKDGQIKS 814

  Fly   758 QEAPFMREMRRVEQK-RQLRAYYRQMRHQEYIRDRCKTEYRAPRHQCDPIYCSNFLCQNPRLAEH 821
            .|.....|:.:|..| :.::|..:::   |.:::..........||                   
  Rat   815 VEELLEVELLKVANKEKTVQALKQEI---EILKEEIGNAQLEKAHQ------------------- 857

  Fly   822 CDCLGAVQELQNLLSGSKDNEDHSRLLLRVENLRKR-VCQRMC 863
            ......||||||||.|.::..|..:..|  |:|..| .|.::|
  Rat   858 LSVTSQVQELQNLLRGKEEQVDSMKAAL--EDLTGREKCTQVC 898

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31797NP_724173.1 None
Ktn1XP_006221968.1 SMC_prok_B 460..1238 CDD:274008 90/494 (18%)
MCP_signal 987..1176 CDD:304920
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_28NEJ
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.