DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31797 and Rrbp1

DIOPT Version :8

Sequence 1:NP_724173.1 Gene:CG31797 / 35203 FlyBaseID:FBgn0051797 Length:868 Species:Drosophila melanogaster
Sequence 2:XP_008773766.1 Gene:Rrbp1 / 311483 RGDID:1306536 Length:1464 Species:Rattus norvegicus

Alignment Length:710 Identity:141/711 (20%)
Similarity:260/711 (37%) Gaps:153/711 (22%)


  Fly   130 KQDKKPSPRDTLAQKNRTPQICKPFVLNRHALQSDLQQIPHVQQQLDPRQAFGTLYCTDHNQVPH 194
            |.:||...: |:.:|.:|          :...:....:||  :..|||..   |:...:..:|| 
  Rat    67 KGEKKKKEK-TVEKKGKT----------KKKEEKPNGKIP--EHDLDPNV---TIILKEPMRVP- 114

  Fly   195 DSTRVA-RQMYTGISRHQVSNIEPARKKDPRGLRHPQWYCPPDGLEPRHGCTQYEWAKRKLDPNP 258
             :..|| ..:::.:.|..|:.: ||.         ||                     .||..:|
  Rat   115 -AVAVAPTSVHSSVGRTPVATV-PAM---------PQ---------------------EKLASSP 147

  Fly   259 NNNEFRHCPQGKDEHKSPEPLNYDQLY---SRIIKCFEPKPSPDPLCEPY-EKCCKP------KR 313
            .:.:.:.....|.|......:|..|:.   |.|::. .||..|.....|. .|...|      |:
  Rat   148 KDKKKKEKKVAKVEPAVSSIVNSIQVLASKSAILEA-SPKEVPMVAVPPVGSKASAPATSSQGKK 211

  Fly   314 SHGKDNQG----GGDSQIPKGPSRPTKSSGDPG--NPIGHGNREPGEEDKVTIVRDDGNGDRGDK 372
            ..|..||.    |..:|..||.....::....|  |.:..|.....:..|....::......|.:
  Rat   212 GQGAQNQAKKGEGAQNQAKKGEGVQNQAKKGEGAQNQVKKGEGAQNQAKKGEGAQNQAKKGEGTQ 276

  Fly   373 ENDKDKNQFVNKDKPRVSIKENDNDGDQNNDKNKDKVVNFNQE----ENKYKNQDRYKNKEDKEK 433
            ...|......|:.|        ..:|.||..|..:...|..::    :|:.|..:..:|:..|.:
  Rat   277 NQAKKGEGAQNQGK--------KGEGAQNQAKKGEGAQNQAKKGEGAQNQAKKGEGAQNQAKKGE 333

  Fly   434 --EREKKKREKAK-EKKKGKDKETE-KKREKVKKKKEKNKETGKGKEKARERDKENYK---GIER 491
              :.:.||.|.|: :.|||:..:.: ||.|.|:.:.:|..|..:.:.|..|.::...|   |.:.
  Rat   334 GGQNQAKKGEGAQNQAKKGEGAQNQAKKGEGVQNQAKKGVEGAQNQGKKGEANQNQAKKGEGGQN 398

  Fly   492 PREKEEGERKEREK----EEEENEIENENNKEKELGKEQEIEKFKERERPHEKDKPMEREQEREE 552
            ..:|.||.:.:.:|    ::::.:||...|:.|:  .|....:.|:.|....:.|..|..|.:.:
  Rat   399 QTKKGEGLQNQGKKGEATQKQDKKIEGAQNQGKK--PEGTPNQGKKGEGAQNQGKKGEGAQNQGK 461

  Fly   553 KGK--QEEKERERGIEKEREKGKGKEKEVNKEHETGKQKEDKNRGKDQFPEKGKEKKQQKHKEKY 615
            ||:  |.:.::..|.:.:.:||:|.:.: .|:.|..:.:..|..|.....:||:..:.|..|.:.
  Rat   462 KGEGAQNQGKKGEGAQNQGKKGEGAQNQ-GKKGEGAQNQGKKGEGAQNQGKKGEGAQNQGKKGEG 525

  Fly   616 KDEDKI-------------------KDMDLEYEKYDRDDIKIPNNKKNKNKSNEDSKIE------ 655
            .....|                   |.|:....:..:.:......||.:...|:..|.:      
  Rat   526 SPSQNIKVEGMQNQGRKAEGTPAQGKKMEAAQNQGKKAEGVQSQGKKGEGSQNQGKKGDGNPNQG 590

  Fly   656 ---ENKPNSNLPEVTSRFFDIPVDMEFDKTIKRGTRVEDYEFPALEIVRDEPAAPTCKLK---DP 714
               |..||.|              .:.|....:||:.|...    ..|:....:|....|   .|
  Rat   591 KKGEGAPNQN--------------RKTDTVANQGTKTEGVS----NQVKKSEGSPNQGKKAEGAP 637

  Fly   715 PKKKKMK----RIKKV--CKDKPKKVCPPCPPAGCQCEICHFMDRPFNEQEAPFMREMRR 768
            .:.||::    :.|||  ...:.|| ....|..|....:....:.|  :||||..::.::
  Rat   638 NQGKKVEGSPNQAKKVDAAAGQGKK-SEMTPAQGKNASMVQSQEAP--KQEAPAKKKSKK 694

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31797NP_724173.1 None
Rrbp1XP_008773766.1 Rib_recp_KP_reg 44..182 CDD:282899 31/164 (19%)
Tropomyosin 832..1080 CDD:278679
PRK02224 967..>1447 CDD:179385
Rootletin 970..>1084 CDD:291694
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_28NEJ
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.