DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: l(2)37Cg and RPC14

Sequence 1:NP_001260563.1 Gene:l(2)37Cg FlyBaseID:FBgn0086447 Length:132 Species:Drosophila melanogaster
Sequence 2:NP_001077977.1 Gene:RPC14 AraportID:AT2G29540 Length:139 Species:Arabidopsis thaliana

Alignment Length:87 Identity:23/88 (26%)
Similarity:39/88 (44%) Gaps:22/88 (25%)


  Fly    68 PEVDFCGYTIPHPTEQKLHFRIQSRRDRAIDILKRGLEDLEGLCDHTIVTFEKEMAE-------- 124
            |.|....||||||:.::::.|:|:..|.|.::.|...::|..:..|....|:|.:||        
plant    52 PRVTVAAYTIPHPSLEQVNIRVQTTGDPAREVFKDACQELMQMNRHVRSVFDKAVAEYKDEQKRK 116

  Fly   125 --------------FNAMKVEN 132
                          |.:|.:||
plant   117 EEAEEEELKRQRDLFGSMDIEN 138

Known Domains:


GeneSequenceDomainRegion External IDIdentity
l(2)37CgNP_001260563.1 RNAP_I_III_AC19 37..118 CDD:132907 15/50 (30%)
RNA_pol_L 46..>80 CDD:279526 7/12 (58%)
RPC14NP_001077977.1 RNAP_RPB11_RPB3 <52..102 CDD:299707 15/50 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1398114at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_128425
Panther 1 1.100 LDO PTHR13946
Phylome 1 0.910 0.667 Consistency score
65.930

Return to query results.
Submit another query.