DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: l(2)37Cg and Rpb11

Sequence 1:NP_001260563.1 Gene:l(2)37Cg FlyBaseID:FBgn0086447 Length:132 Species:Drosophila melanogaster
Sequence 2:NP_609836.1 Gene:Rpb11 FlyBaseID:FBgn0032634 Length:117 Species:Drosophila melanogaster

Alignment Length:48 Identity:21/49 (43%)
Similarity:27/49 (55%) Gaps:0/49 (0%)


  Fly    47 FVFTNEGHTLGNALKTIIARYPEVDFCGYTIPHPTEQKLHFRIQSRRD 94
            |....|.|||||.::..:.:.|.|.|.||.:|||.|.|...|||:..|
  Fly    33 FTINKEDHTLGNMIRNQLLKDPNVLFAGYKVPHPLEHKFVIRIQTTAD 80

Known Domains:


GeneSequenceDomainRegion External IDIdentity
l(2)37CgNP_001260563.1 RNAP_I_III_AC19 37..118 CDD:132907 21/49 (43%)
RNA_pol_L 46..>80 CDD:279526 14/33 (42%)
Rpb11NP_609836.1 RNAP_II_RPB11 14..105 CDD:132902 21/49 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C139789
eggNOG 1 0.900 E1_COG1761
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1398114at2759
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR13946
RoundUp 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.