DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: l(2)37Cg and rpc19

Sequence 1:NP_001260563.1 Gene:l(2)37Cg FlyBaseID:FBgn0086447 Length:132 Species:Drosophila melanogaster
Sequence 2:NP_593118.2 Gene:rpc19 PomBaseID:SPAC1687.01 Length:125 Species:Schizosaccharomyces pombe

Alignment Length:89 Identity:40/90 (44%)
Similarity:60/90 (67%) Gaps:1/90 (1%)


  Fly    44 SRTFVFTNEGHTLGNALKTIIARYPEVDFCGYTIPHPTEQKLHFRIQSR-RDRAIDILKRGLEDL 107
            |.||....|.|||||:|:.:|.:.|||:||||:||||:|.|::||||:. ...|:|:|::||:||
pombe    34 SVTFQIQKEDHTLGNSLRYVIMKNPEVEFCGYSIPHPSEAKMNFRIQTAPSTTAVDVLRKGLDDL 98

  Fly   108 EGLCDHTIVTFEKEMAEFNAMKVE 131
            ..|||.....|.:::....:..:|
pombe    99 IDLCDAVTEKFTEQLPRDTSTTME 122

Known Domains:


GeneSequenceDomainRegion External IDIdentity
l(2)37CgNP_001260563.1 RNAP_I_III_AC19 37..118 CDD:132907 38/75 (51%)
RNA_pol_L 46..>80 CDD:279526 20/34 (59%)
rpc19NP_593118.2 RNAP_I_III_AC19 25..109 CDD:132907 38/75 (51%)
RNA_pol_L 36..102 CDD:279526 35/66 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H22239
Inparanoid 1 1.050 86 1.000 Inparanoid score I1761
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0005115
OrthoInspector 1 1.000 T1125338
orthoMCL 1 0.900 OOG5_128425
Panther 1 1.100 LDO PTHR13946
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1181
TreeFam 1 0.960
109.950

Return to query results.
Submit another query.