DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: l(2)37Cg and Polr1d

Sequence 1:NP_001260563.1 Gene:l(2)37Cg FlyBaseID:FBgn0086447 Length:132 Species:Drosophila melanogaster
Sequence 2:NP_033113.1 Gene:Polr1d MGIID:108403 Length:133 Species:Mus musculus

Alignment Length:85 Identity:39/86 (45%)
Similarity:56/86 (65%) Gaps:1/86 (1%)


  Fly    46 TFVFTNEGHTLGNALKTIIARYPEVDFCGYTIPHPTEQKLHFRIQSRRD-RAIDILKRGLEDLEG 109
            |||...|.|||||.|:.||.:.|||:|||||..||:|.|::.|||:|.. .|::..::||.:|..
Mouse    41 TFVLHEEDHTLGNCLRYIIMKNPEVEFCGYTTTHPSESKINLRIQTRGALPAVEPFQKGLNELLN 105

  Fly   110 LCDHTIVTFEKEMAEFNAMK 129
            :|.|.:|.||..:.::.|.|
Mouse   106 VCQHVLVKFEASIKDYKAKK 125

Known Domains:


GeneSequenceDomainRegion External IDIdentity
l(2)37CgNP_001260563.1 RNAP_I_III_AC19 37..118 CDD:132907 35/73 (48%)
RNA_pol_L 46..>80 CDD:279526 21/34 (62%)
Polr1dNP_033113.1 RNAP_I_III_AC19 30..114 CDD:132907 35/73 (48%)
RNA_pol_L 41..>70 CDD:279526 18/29 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C219213823
eggNOG 1 0.900 E1_COG1761
Hieranoid 1 1.000
Homologene 1 1.000 H22239
Inparanoid 1 1.050 84 1.000 Inparanoid score I5125
Isobase 1 0.950 0 Normalized mean entropy S862
OMA 1 1.010
OrthoDB 1 1.010 D1398114at2759
OrthoFinder 1 1.000 FOG0005115
OrthoInspector 1 1.000 T1084323
orthoMCL 1 0.900 OOG5_128425
Panther 1 1.100 LDO PTHR13946
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1181
TreeFam 1 0.960
1514.750

Return to query results.
Submit another query.