DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: l(2)37Cg and polr1d.2

Sequence 1:NP_001260563.1 Gene:l(2)37Cg FlyBaseID:FBgn0086447 Length:132 Species:Drosophila melanogaster
Sequence 2:XP_017952449.1 Gene:polr1d.2 XenbaseID:XB-GENE-5852282 Length:140 Species:Xenopus tropicalis

Alignment Length:63 Identity:27/64 (42%)
Similarity:43/64 (67%) Gaps:1/64 (2%)


  Fly    68 PEVDFCGYTIPHPTEQKLHFRIQSRRD-RAIDILKRGLEDLEGLCDHTIVTFEKEMAEFNAMK 129
            |:::||||:|.||:|.|::||||:|.. .|::..:|||.:|..:|.|.:.|||..:.|:...|
 Frog    73 PDIEFCGYSITHPSETKINFRIQTRNGIPAVEPFRRGLTELVDVCQHVLNTFEASIKEYKEQK 135

Known Domains:


GeneSequenceDomainRegion External IDIdentity
l(2)37CgNP_001260563.1 RNAP_I_III_AC19 37..118 CDD:132907 23/51 (45%)
RNA_pol_L 46..>80 CDD:279526 7/12 (58%)
polr1d.2XP_017952449.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H22239
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1398114at2759
OrthoFinder 1 1.000 FOG0005115
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.